Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Content subtype: bmr10062_3.str

Assigned chemical shifts

1. Saveframe: Nedd8
   • Status: OK
   • Sequence coverage of experimental data
     • Entity_assembly_ID: 1, Chain length: 96, Sequence coverage: 75.0%

     --------10--------20--------30--------40--------50--------60--------70--------80--------90------
     MGSSHHHHHHSSGLVPRGSHMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
                         |||||||||||||||||| ||||||||||| |||||  ||||||||||||||||||||||||||||||||||||||
     ....................MLIKVKTLTGKEIEIDIE.TDKVERIKERV.EKEGI..QQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
     

   • Total number of assignments
     • ¹H chemical shifts: 72
     • ¹⁵N chemical shifts: 72
   • Completeness of assignments
     • Entity_assemble_ID: 1
       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	588	72	12.2
         15N chemical shifts	102	72	70.6

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	198	72	36.4
         15N chemical shifts	92	72	78.3

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	390	0	0.0
         15N chemical shifts	10	0	0.0

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	56	0	0.0

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	24	0	0.0

   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: 1