Resonance assignment of the first and second KH (hnRNP-K homology) domains of human poly(C)-binding protein-2 (PCBP2)
MKHHHHHHKN VTLTIRLLMH GKEVGSIIGK KGESVKKMRE ESGARINISE GNCPERIITL AGPTNAIFKA FAMIIGKLEE DISSSMTNST AASRPPVTLR LVVPASQCGS LIGKGGCKIK EIRESTGAQV QVAGDMLPNS TERAITIAGI PQSIIECVKQ ICVVMLET
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.7 % (1663 of 1897) | 87.2 % (862 of 988) | 86.2 % (635 of 737) | 96.5 % (166 of 172) |
Backbone | 92.5 % (919 of 994) | 92.2 % (317 of 344) | 91.4 % (447 of 489) | 96.3 % (155 of 161) |
Sidechain | 83.2 % (879 of 1056) | 84.6 % (545 of 644) | 80.5 % (323 of 401) | 100.0 % (11 of 11) |
Aromatic | 4.2 % (2 of 48) | 8.3 % (2 of 24) | 0.0 % (0 of 24) | |
Methyl | 98.1 % (206 of 210) | 98.1 % (103 of 105) | 98.1 % (103 of 105) |
1. PCBP2 KH1 and KH2 domains
MKHHHHHHKN VTLTIRLLMH GKEVGSIIGK KGESVKKMRE ESGARINISE GNCPERIITL AGPTNAIFKA FAMIIGKLEE DISSSMTNST AASRPPVTLR LVVPASQCGS LIGKGGCKIK EIRESTGAQV QVAGDMLPNS TERAITIAGI PQSIIECVKQ ICVVMLETSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PCBP2 KH1 and KH2 domains | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | 10 % | ||
3 | D2O | 90 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr15049_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKHHHHHHKNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIGKLEEDISSSMTNSTAASRPPVTLR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||| ........KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIGKLEEDISSSMTNSTAASR.PVTLR -------110-------120-------130-------140-------150-------160-------- LVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLET |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLET
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
12 | THR | HG1 | 4.909 |
14 | THR | HG1 | 5.096 |
16 | ARG | HH11 | 6.829 |
16 | ARG | HH12 | 6.829 |
16 | ARG | HH21 | 6.828 |
16 | ARG | HH22 | 6.828 |
39 | ARG | HH11 | 6.785 |
39 | ARG | HH12 | 6.785 |
39 | ARG | HH21 | 6.81 |
39 | ARG | HH22 | 6.81 |
42 | SER | HG | 5.462 |
45 | ARG | HH11 | 6.612 |
45 | ARG | HH12 | 6.612 |
45 | ARG | HH21 | 6.612 |
45 | ARG | HH22 | 6.612 |
49 | SER | HG | 5.327 |
53 | CYS | HG | 1.934 |
56 | ARG | HH11 | 6.767 |
56 | ARG | HH12 | 6.767 |
56 | ARG | HH21 | 6.776 |
56 | ARG | HH22 | 6.776 |
59 | THR | HG1 | 4.872 |
64 | THR | HG1 | 4.751 |
98 | THR | HG1 | 5.173 |
100 | ARG | HH11 | 6.901 |
100 | ARG | HH12 | 6.901 |
100 | ARG | HH21 | 6.892 |
100 | ARG | HH22 | 6.892 |
123 | ARG | HH11 | 7.207 |
123 | ARG | HH12 | 7.207 |
123 | ARG | HH21 | 7.194 |
123 | ARG | HH22 | 7.194 |
126 | THR | HG1 | 4.756 |
141 | THR | HG1 | 4.735 |
143 | ARG | HH11 | 6.776 |
143 | ARG | HH12 | 6.776 |
143 | ARG | HH21 | 6.677 |
143 | ARG | HH22 | 6.677 |
146 | THR | HG1 | 4.656 |
162 | CYS | HG | 2.804 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 988 | 880 | 89.1 |
13C chemical shifts | 737 | 626 | 84.9 |
15N chemical shifts | 180 | 172 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 344 | 323 | 93.9 |
13C chemical shifts | 336 | 310 | 92.3 |
15N chemical shifts | 161 | 153 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 644 | 557 | 86.5 |
13C chemical shifts | 401 | 316 | 78.8 |
15N chemical shifts | 19 | 19 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 112 | 103 | 92.0 |
13C chemical shifts | 112 | 102 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 24 | 2 | 8.3 |
13C chemical shifts | 24 | 0 | 0.0 |