OSCP-NT (1-120) in complex with N-terminal (1-25) alpha subunit from F1-ATPase
FAKLVRPPVQ IYGIEGRYAT ALYSAASKQN KLEQVEKELL RVGQILKEPK MAASLLNPYV KRSVKVKSLS DMTAKEKFSP LTSNLINLLA ENGRLTNTPA VISAFSTMMS VHRGEVPCTV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 56.6 % (949 of 1678) | 66.5 % (580 of 872) | 40.0 % (263 of 657) | 71.1 % (106 of 149) |
Backbone | 54.4 % (466 of 856) | 77.6 % (225 of 290) | 33.4 % (143 of 428) | 71.0 % (98 of 138) |
Sidechain | 56.9 % (546 of 960) | 61.0 % (355 of 582) | 49.9 % (183 of 367) | 72.7 % (8 of 11) |
Aromatic | 93.9 % (62 of 66) | 93.9 % (31 of 33) | 93.9 % (31 of 33) | |
Methyl | 72.2 % (140 of 194) | 84.5 % (82 of 97) | 59.8 % (58 of 97) |
1. oscp-nt
FAKLVRPPVQ IYGIEGRYAT ALYSAASKQN KLEQVEKELL RVGQILKEPK MAASLLNPYV KRSVKVKSLS DMTAKEKFSP LTSNLINLLA ENGRLTNTPA VISAFSTMMS VHRGEVPCTV2. alpha-nt
QKTGTAEVSS ILEERILGAD TSVDLSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | oscp-nt | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | alpha-nt | natural abundance | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | oscp-nt | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | alpha-nt | natural abundance | 1.5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_15072_2jmx.nef |
Input source #2: Coordindates | 2jmx.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPA -------110-------120 VISAFSTMMSVHRGEVPCTV |||||||||||||||||||| VISAFSTMMSVHRGEVPCTV
--------10--------20----- QKTGTAEVSSILEERILGADTSVDL ||||||||||||||||||||||||| QKTGTAEVSSILEERILGADTSVDL
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 120 | 0 | 0 | 100.0 |
B | B | 25 | 0 | 0 | 100.0 |
Content subtype: combined_15072_2jmx.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPA |||||||||||||| |||||||| ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FAKLVRPPVQIYGI.GRYATALY.AAS.QNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPA -------110-------120 VISAFSTMMSVHRGEVPCTV |||||||||||||||||||| VISAFSTMMSVHRGEVPCTV
--------10--------20----- QKTGTAEVSSILEERILGADTSVDL ||||||||||||||||||||||||| QKTGTAEVSSILEERILGADTSVDL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 738 | 439 | 59.5 |
13C chemical shifts | 553 | 222 | 40.1 |
15N chemical shifts | 129 | 100 | 77.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 238 | 167 | 70.2 |
13C chemical shifts | 240 | 52 | 21.7 |
15N chemical shifts | 113 | 92 | 81.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 500 | 272 | 54.4 |
13C chemical shifts | 313 | 170 | 54.3 |
15N chemical shifts | 16 | 8 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 67 | 81.7 |
13C chemical shifts | 82 | 60 | 73.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 31 | 93.9 |
13C chemical shifts | 33 | 31 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 134 | 127 | 94.8 |
13C chemical shifts | 104 | 0 | 0.0 |
15N chemical shifts | 27 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 50 | 96.2 |
13C chemical shifts | 50 | 0 | 0.0 |
15N chemical shifts | 25 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 77 | 93.9 |
13C chemical shifts | 54 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 19 | 19 | 100.0 |
13C chemical shifts | 19 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Distance restraints
--------10--------20----- QKTGTAEVSSILEERILGADTSVDL ||||||||||||||||||||||| ..TGTAEVSSILEERILGADTSVDL
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPA -------110-------120 VISAFSTMMSVHRGEVPCTV |||||||||||||||||||| VISAFSTMMSVHRGEVPCTV