Solution NMR structure of the ygdR protein from Escherichia coli. Northeast Structural Genomics target ER382A.
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 71.6 % (490 of 684) | 71.5 % (254 of 355) | 71.5 % (188 of 263) | 72.7 % (48 of 66) |
Backbone | 72.8 % (265 of 364) | 75.2 % (94 of 125) | 71.5 % (128 of 179) | 71.7 % (43 of 60) |
Sidechain | 71.4 % (269 of 377) | 69.6 % (160 of 230) | 73.8 % (104 of 141) | 83.3 % (5 of 6) |
Aromatic | 40.9 % (18 of 44) | 40.9 % (9 of 22) | 40.9 % (9 of 22) | |
Methyl | 100.0 % (54 of 54) | 100.0 % (27 of 27) | 100.0 % (27 of 27) |
1. ER382A
MSSDYVMATK DGRMILTDGK PEIDDDTGLV SYHDQQGNAM QINRDDVSQI IERLEHHHHH HSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details PST ID ER382A.007 NC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER382A | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | CaCl2 | natural abundance | 5 mM | |
4 | NaCl | natural abundance | 0.1 M | |
5 | MES | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15079_2jn0.nef |
Input source #2: Coordindates | 2jn0.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60- MSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIERLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIERLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 61 | 0 | 0 | 100.0 |
Content subtype: combined_15079_2jn0.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60- MSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIERLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||| ....YVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIERL --------10--------20--------30--------40--------50----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
17 | THR | HG1 | 5.586 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 355 | 253 | 71.3 |
13C chemical shifts | 263 | 188 | 71.5 |
15N chemical shifts | 69 | 50 | 72.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 125 | 93 | 74.4 |
13C chemical shifts | 122 | 84 | 68.9 |
15N chemical shifts | 60 | 43 | 71.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 230 | 160 | 69.6 |
13C chemical shifts | 141 | 104 | 73.8 |
15N chemical shifts | 9 | 7 | 77.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 30 | 96.8 |
13C chemical shifts | 31 | 30 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 9 | 40.9 |
13C chemical shifts | 22 | 9 | 40.9 |
Distance restraints
--------10--------20--------30--------40--------50--------60- MSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIERLEHHHHHH ||||||||||||| |||||||||||||||||||||||||||||||| .....VMATKDGRMILTD.KPEIDDDTGLVSYHDQQGNAMQINRDDVSQII --------10--------20--------30--------40--------50-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60- MSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIERLEHHHHHH ||||| |||||||||||||| ||||||| ||||| .....VMATK.GRMILTDGKPEIDD..GLVSYHD....AMQIN --------10--------20--------30--------40---