Solution NMR structure of Q8ZRJ2 from Salmonella typhimurium. Northeast Structural Genomics target StR65.
MVNFKDKSMP TAIEKALDFI GGMNTSASVP HSMDESTAKG ILKYLHDLGV PVSPEVVVAR GEQEGWNPEF TKKVAGWAEK VASGNRILIK NPEYFSTYMQ EQLKELVLEH HHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.8 % (1238 of 1348) | 92.4 % (647 of 700) | 91.3 % (483 of 529) | 90.8 % (108 of 119) |
Backbone | 92.0 % (624 of 678) | 93.1 % (216 of 232) | 92.0 % (310 of 337) | 89.9 % (98 of 109) |
Sidechain | 91.8 % (713 of 777) | 92.1 % (431 of 468) | 91.0 % (272 of 299) | 100.0 % (10 of 10) |
Aromatic | 76.7 % (92 of 120) | 76.7 % (46 of 60) | 75.9 % (44 of 58) | 100.0 % (2 of 2) |
Methyl | 100.0 % (118 of 118) | 100.0 % (59 of 59) | 100.0 % (59 of 59) |
1. StR65
MVNFKDKSMP TAIEKALDFI GGMNTSASVP HSMDESTAKG ILKYLHDLGV PVSPEVVVAR GEQEGWNPEF TKKVAGWAEK VASGNRILIK NPEYFSTYMQ EQLKELVLEH HHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | StR65 | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | StR65 | [U-5% 13C; U-100% 15N] | 0.89 mM | |
8 | MES | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | sodium azide | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | StR65 | carbon | 0.0 ppm | external | indirect | 0.2514495 |
1H | StR65 | protons | 0.0 ppm | external | direct | 1.0 |
15N | StR65 | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | StR65 | carbon | 0.0 ppm | external | indirect | 0.2514495 |
1H | StR65 | protons | 0.0 ppm | external | direct | 1.0 |
15N | StR65 | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | StR65 | carbon | 0.0 ppm | external | indirect | 0.2514495 |
1H | StR65 | protons | 0.0 ppm | external | direct | 1.0 |
15N | StR65 | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | StR65 | carbon | 0.0 ppm | external | indirect | 0.2514495 |
1H | StR65 | protons | 0.0 ppm | external | direct | 1.0 |
15N | StR65 | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | StR65 | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | StR65 | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | StR65 | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | StR65 | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | StR65 | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | StR65 | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | StR65 | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker AMX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | StR65 | [U-100% 13C; U-100% 15N] | 1.17 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | StR65 | [U-5% 13C; U-100% 15N] | 0.89 mM | |
8 | MES | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | sodium azide | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15089_2jn8.nef |
Input source #2: Coordindates | 2jn8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVNFKDKSMPTAIEKALDFIGGMNTSASVPHSMDESTAKGILKYLHDLGVPVSPEVVVARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVNFKDKSMPTAIEKALDFIGGMNTSASVPHSMDESTAKGILKYLHDLGVPVSPEVVVARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQ -------110----- EQLKELVLEHHHHHH ||||||||||||||| EQLKELVLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 115 | 0 | 0 | 100.0 |
Content subtype: combined_15089_2jn8.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVNFKDKSMPTAIEKALDFIGGMNTSASVPHSMDESTAKGILKYLHDLGVPVSPEVVVARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVNFKDKSMPTAIEKALDFIGGMNTSASVPHSMDESTAKGILKYLHDLGVPVSPEVVVARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110----- EQLKELVLEHHHHHH ||||||||| EQLKELVLE ---------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 529 | 483 | 91.3 |
1H chemical shifts | 700 | 646 | 92.3 |
15N chemical shifts | 121 | 108 | 89.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 230 | 211 | 91.7 |
1H chemical shifts | 232 | 215 | 92.7 |
15N chemical shifts | 109 | 96 | 88.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 299 | 272 | 91.0 |
1H chemical shifts | 468 | 431 | 92.1 |
15N chemical shifts | 12 | 12 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 64 | 61 | 95.3 |
1H chemical shifts | 64 | 61 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 58 | 44 | 75.9 |
1H chemical shifts | 60 | 46 | 76.7 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVNFKDKSMPTAIEKALDFIGGMNTSASVPHSMDESTAKGILKYLHDLGVPVSPEVVVARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .VNFKDKSMPTAIEKALDFIGGMNTSASVPHSMDESTAKGILKYLHDLGVPVSPEVVVARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110----- EQLKELVLEHHHHHH ||||||||| EQLKELVLE ---------
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVNFKDKSMPTAIEKALDFIGGMNTSASVPHSMDESTAKGILKYLHDLGVPVSPEVVVARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQ |||||||||| ||||||||||||| ||||||||||| |||||||||||||||| |||| ...........AIEKALDFIG.............ESTAKGILKYLHD.......EVVVARGEQEG...EFTKKVAGWAEKVASG............TYMQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110----- EQLKELVLEHHHHHH |||||||| EQLKELVL --------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVNFKDKSMPTAIEKALDFIGGMNTSASVPHSMDESTAKGILKYLHDLGVPVSPEVVVARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQ ||||||||||| ||||||||||||||||||||| ||||||||||| ||||||||||||||||| |||||| ..........TAIEKALDFIG.........HSMDESTAKGILKYLHDLGVP..PEVVVARGEQE...PEFTKKVAGWAEKVASG..........FSTYMQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110----- EQLKELVLEHHHHHH |||||||||| EQLKELVLEH -------110