Solution structure of dynein light chain 2A
GPLGSMAEVE ETLKRLQSQK GVQGIIVVNT EGIPIKSTMD NPTTTQYASL MHSFILKARS TVRDIDPQND LTFLRIRSKK NEIMVAPDKD YFLIVIQNPT E
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.0 % (930 of 1193) | 84.3 % (526 of 624) | 67.8 % (314 of 463) | 84.9 % (90 of 106) |
Backbone | 78.8 % (468 of 594) | 91.5 % (184 of 201) | 65.1 % (194 of 298) | 94.7 % (90 of 95) |
Sidechain | 79.7 % (554 of 695) | 80.9 % (342 of 423) | 81.2 % (212 of 261) | 0.0 % (0 of 11) |
Aromatic | 4.0 % (2 of 50) | 8.0 % (2 of 25) | 0.0 % (0 of 25) | |
Methyl | 92.1 % (116 of 126) | 92.1 % (58 of 63) | 92.1 % (58 of 63) |
1. Dynein light chain 2A, cytoplasmic
GPLGSMAEVE ETLKRLQSQK GVQGIIVVNT EGIPIKSTMD NPTTTQYASL MHSFILKARS TVRDIDPQND LTFLRIRSKK NEIMVAPDKD YFLIVIQNPT ESolvent system 95% H2O, 5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6mM DL2A U-15, 13C; 20mM phosphate buffer NA; 20mM NaCl; 0.1mM EDTA; 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dynein light chain 2A, cytoplasmic | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 0.1 mM | |
4 | EDTA | natural abundance | 20 mM | |
5 | H2O | 95 % | ||
6 | D2O | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6mM DL2A U-15, 13C; 20mM phosphate buffer NA; 20mM NaCl; 0.1mM EDTA; 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Dynein light chain 2A, cytoplasmic | [U-100% 13C; U-100% 15N] | 0.6 mM | |
8 | phosphate buffer | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 0.1 mM | |
10 | EDTA | natural abundance | 20 mM | |
11 | D2O | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 95% H2O, 5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6mM DL2A U-15, 13C; 20mM phosphate buffer NA; 20mM NaCl; 0.1mM EDTA; 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dynein light chain 2A, cytoplasmic | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 0.1 mM | |
4 | EDTA | natural abundance | 20 mM | |
5 | H2O | 95 % | ||
6 | D2O | 5 % |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6mM DL2A U-15, 13C; 20mM phosphate buffer NA; 20mM NaCl; 0.1mM EDTA; 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Dynein light chain 2A, cytoplasmic | [U-100% 13C; U-100% 15N] | 0.6 mM | |
8 | phosphate buffer | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 0.1 mM | |
10 | EDTA | natural abundance | 20 mM | |
11 | D2O | 100 % |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6mM DL2A U-15, 13C; 20mM phosphate buffer NA; 20mM NaCl; 0.1mM EDTA; 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Dynein light chain 2A, cytoplasmic | [U-100% 13C; U-100% 15N] | 0.6 mM | |
8 | phosphate buffer | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 0.1 mM | |
10 | EDTA | natural abundance | 20 mM | |
11 | D2O | 100 % |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 95% H2O, 5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6mM DL2A U-15, 13C; 20mM phosphate buffer NA; 20mM NaCl; 0.1mM EDTA; 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dynein light chain 2A, cytoplasmic | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 0.1 mM | |
4 | EDTA | natural abundance | 20 mM | |
5 | H2O | 95 % | ||
6 | D2O | 5 % |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 95% H2O, 5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6mM DL2A U-15, 13C; 20mM phosphate buffer NA; 20mM NaCl; 0.1mM EDTA; 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dynein light chain 2A, cytoplasmic | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 0.1 mM | |
4 | EDTA | natural abundance | 20 mM | |
5 | H2O | 95 % | ||
6 | D2O | 5 % |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6mM DL2A U-15, 13C; 20mM phosphate buffer NA; 20mM NaCl; 0.1mM EDTA; 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Dynein light chain 2A, cytoplasmic | [U-100% 13C; U-100% 15N] | 0.6 mM | |
8 | phosphate buffer | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 0.1 mM | |
10 | EDTA | natural abundance | 20 mM | |
11 | D2O | 100 % |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.6mM DL2A U-15, 13C; 20mM phosphate buffer NA; 20mM NaCl; 0.1mM EDTA; 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Dynein light chain 2A, cytoplasmic | [U-100% 13C; U-100% 15N] | 0.6 mM | |
8 | phosphate buffer | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 0.1 mM | |
10 | EDTA | natural abundance | 20 mM | |
11 | D2O | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_15142_2e8j.nef |
Input source #2: Coordindates | 2e8j.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- GPLGSMAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSMAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 - E | E -
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- GPLGSMAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSMAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 - E | E -
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 101 | 0 | 0 | 100.0 |
B | B | 101 | 0 | 0 | 100.0 |
Content subtype: combined_15142_2e8j.nef
Assigned chemical shifts
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- GPLGSMAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT ||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMD.PTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT - E | E
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 624 | 533 | 85.4 |
13C chemical shifts | 463 | 305 | 65.9 |
15N chemical shifts | 111 | 90 | 81.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 201 | 188 | 93.5 |
13C chemical shifts | 202 | 95 | 47.0 |
15N chemical shifts | 95 | 90 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 423 | 345 | 81.6 |
13C chemical shifts | 261 | 210 | 80.5 |
15N chemical shifts | 16 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 58 | 86.6 |
13C chemical shifts | 67 | 57 | 85.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 25 | 0 | 0.0 |
13C chemical shifts | 25 | 0 | 0.0 |
Distance restraints
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- GPLGSMAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT ||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMD.PTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT - E | E
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- GPLGSMAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT ||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMD.PTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPT - E | E