Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Content subtype: bmr15235_3.str

Assigned chemical shifts

1. Saveframe: assigned_chem_shift_list_1
   • Status: OK
   • Sequence coverage of experimental data
     • Entity_assembly_ID: 1, Chain length: 123, Sequence coverage: 84.6%

     --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
     GAMDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIRLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLA
        |||||||||||||||||||||||||| ||||||||||| |||||||||  || ||||   ||||| || ||| ||||| ||||| ||||||||||||
     ...DETTYERLAEETLDSLAEFFEDLADK.YTFEDYDVSFG.GVLTVKLGG..GT.VINK...NKQIR.SS.SSG.KRYDW.GKNWV.SHDGVSLHELLA
     --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
     
     -------110-------120---
     AELTKALKTKLDLSSLAYSGKDA
     ||||||||| |||||||||| | 
     AELTKALKT.LDLSSLAYSG.D 
     -------110-------120-- 
     

   • Total number of assignments
     • ¹H chemical shifts: 106
     • ¹⁵N chemical shifts: 106
   • Completeness of assignments
     • Entity_assemble_ID: 1
       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	719	106	14.7
         15N chemical shifts	129	106	82.2

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	252	104	41.3
         15N chemical shifts	119	104	87.4

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	467	2	0.4
         15N chemical shifts	10	2	20.0

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	68	0	0.0

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	64	2	3.1
         15N chemical shifts	2	2	100.0

   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: 1