solution structure of NESG target SsR10, Orf c02003 protein
MSISTSAEVY YEEAEEFLSK GDLVQACEKY YKAAEEAIKL LVIENNLKEI TNNVKNKGRW KSENLFKASK LLRSNNTEIP ILWKSAWTLH VEGFHELSLN EKEVKKLKED VRKLVIFAVN SLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.3 % (1510 of 1584) | 96.0 % (793 of 826) | 93.5 % (576 of 616) | 99.3 % (141 of 142) |
Backbone | 98.7 % (762 of 772) | 98.1 % (255 of 260) | 99.0 % (380 of 384) | 99.2 % (127 of 128) |
Sidechain | 93.1 % (873 of 938) | 95.1 % (538 of 566) | 89.7 % (321 of 358) | 100.0 % (14 of 14) |
Aromatic | 62.9 % (88 of 140) | 74.3 % (52 of 70) | 49.3 % (33 of 67) | 100.0 % (3 of 3) |
Methyl | 100.0 % (150 of 150) | 100.0 % (75 of 75) | 100.0 % (75 of 75) |
1. Orf c02003 protein
MSISTSAEVY YEEAEEFLSK GDLVQACEKY YKAAEEAIKL LVIENNLKEI TNNVKNKGRW KSENLFKASK LLRSNNTEIP ILWKSAWTLH VEGFHELSLN EKEVKKLKED VRKLVIFAVN SLEHHHHHHPressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.1 mM |
Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | entity | natural abundance | 1.0 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.1 mM |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.1 mM |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.1 mM |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.1 mM |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.1 mM |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.1 mM |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | entity | natural abundance | 1.0 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15265_2jpu.nef |
Input source #2: Coordindates | 2jpu.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLN -------110-------120--------- EKEVKKLKEDVRKLVIFAVNSLEHHHHHH ||||||||||||||||||||||||||||| EKEVKKLKEDVRKLVIFAVNSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 129 | 0 | 0 | 100.0 |
Content subtype: combined_15265_2jpu.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLN -------110-------120--------- EKEVKKLKEDVRKLVIFAVNSLEHHHHHH ||||||||||||||||||||||||||||| EKEVKKLKEDVRKLVIFAVNSLEHHHHHH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 616 | 574 | 93.2 |
1H chemical shifts | 826 | 796 | 96.4 |
15N chemical shifts | 145 | 141 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 258 | 255 | 98.8 |
1H chemical shifts | 260 | 258 | 99.2 |
15N chemical shifts | 128 | 127 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 358 | 319 | 89.1 |
1H chemical shifts | 566 | 538 | 95.1 |
15N chemical shifts | 17 | 14 | 82.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 76 | 75 | 98.7 |
1H chemical shifts | 76 | 75 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 67 | 31 | 46.3 |
1H chemical shifts | 70 | 50 | 71.4 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..ISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120--------- EKEVKKLKEDVRKLVIFAVNSLEHHHHHH |||||||||||||||||||||||||| EKEVKKLKEDVRKLVIFAVNSLEHHH -------110-------120------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...STSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120--------- EKEVKKLKEDVRKLVIFAVNSLEHHHHHH |||||||||||||||||||||||||| EKEVKKLKEDVRKLVIFAVNSLEHHH -------110-------120------