Automated NMR Structure of the UBB by FAPSY
GSLVPRGSMQ IFVKTLTGKT ITLEVEPSDT IENVKAKIQD KEGIPPDQQR LIFAGKQLED GRTLSEYNIQ KESTLHLVLR LRGYADLRED PDRQDHHPGS GAQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 77.8 % (933 of 1199) | 82.9 % (524 of 632) | 68.5 % (315 of 460) | 87.9 % (94 of 107) |
Backbone | 81.5 % (494 of 606) | 95.2 % (199 of 209) | 67.3 % (202 of 300) | 95.9 % (93 of 97) |
Sidechain | 77.1 % (530 of 687) | 76.8 % (325 of 423) | 80.3 % (204 of 254) | 10.0 % (1 of 10) |
Aromatic | 20.8 % (10 of 48) | 33.3 % (8 of 24) | 8.3 % (2 of 24) | |
Methyl | 93.9 % (107 of 114) | 94.7 % (54 of 57) | 93.0 % (53 of 57) |
1. UBB
GSLVPRGSMQ IFVKTLTGKT ITLEVEPSDT IENVKAKIQD KEGIPPDQQR LIFAGKQLED GRTLSEYNIQ KESTLHLVLR LRGYADLRED PDRQDHHPGS GAQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBB | [U-98% 13C; U-98% 15N] | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBB | [U-98% 13C; U-98% 15N] | 1 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBB | [U-98% 13C; U-98% 15N] | 1 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBB | [U-98% 13C; U-98% 15N] | 1 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBB | [U-98% 13C; U-98% 15N] | 1 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBB | [U-98% 13C; U-98% 15N] | 1 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBB | [U-98% 13C; U-98% 15N] | 1 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBB | [U-98% 13C; U-98% 15N] | 1 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBB | [U-98% 13C; U-98% 15N] | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Dihedral angle restraints | combined_15689_2k25.nef |
Input source #2: Coordindates | 2k25.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSLVPRGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSEYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSLVPRGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSEYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGS --- GAQ ||| GAQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 103 | 0 | 0 | 100.0 |
Content subtype: combined_15689_2k25.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSLVPRGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSEYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGS |||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| |||||||||| GSLVPRGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI.PDQQRLIFAGKQLEDGRTLSEYNIQKESTLHLVLRLRGYADLR..PDRQDHHPGS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --- GAQ || GA --
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
2 | SER | HG | 5.044 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 632 | 508 | 80.4 |
13C chemical shifts | 460 | 294 | 63.9 |
15N chemical shifts | 114 | 92 | 80.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 209 | 199 | 95.2 |
13C chemical shifts | 206 | 99 | 48.1 |
15N chemical shifts | 97 | 92 | 94.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 423 | 309 | 73.0 |
13C chemical shifts | 254 | 195 | 76.8 |
15N chemical shifts | 17 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 53 | 91.4 |
13C chemical shifts | 58 | 52 | 89.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 24 | 4 | 16.7 |
13C chemical shifts | 24 | 0 | 0.0 |
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSLVPRGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSEYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGS |||| ||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||| |||||||||| .SLVP..SMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL...RTLSEYNIQK.STLHLVLRLR --------10--------20--------30--------40--------50--------60--------70--------80-- --- GAQ