1H, 13C and 15N resonance assignments of the ribosome binding domain of E. coli Trigger Factor
MQVSVETTQG LGRRVTITIA ADSIETAVKS ELVNVAKKVR IDGFRKGKVP MNIVAQRYGA SVRQDVLGDL MSRNFIDAII KEKINPAGAP TYVPGEYKLG EDFTYSVEFE VYPEVEL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.2 % (1220 of 1353) | 89.7 % (629 of 701) | 89.3 % (475 of 532) | 96.7 % (116 of 120) |
Backbone | 97.5 % (675 of 692) | 95.4 % (227 of 238) | 99.1 % (339 of 342) | 97.3 % (109 of 112) |
Sidechain | 84.9 % (653 of 769) | 86.8 % (402 of 463) | 81.9 % (244 of 298) | 87.5 % (7 of 8) |
Aromatic | 75.0 % (60 of 80) | 75.0 % (30 of 40) | 75.0 % (30 of 40) | |
Methyl | 96.1 % (146 of 152) | 96.1 % (73 of 76) | 96.1 % (73 of 76) |
1. E. coli TF-RBD
MQVSVETTQG LGRRVTITIA ADSIETAVKS ELVNVAKKVR IDGFRKGKVP MNIVAQRYGA SVRQDVLGDL MSRNFIDAII KEKINPAGAP TYVPGEYKLG EDFTYSVEFE VYPEVELSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 700 MHz Cryo TXI
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.35, Details TF-RBD 1-117 in 10mM Tris, 200mM (NH4)2.SO4, pH 7.35, 298K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli TF-RBD | [U-98% 13C; U-98% 15N] | 0.2 mM | |
2 | Tris | natural abundance | 10 uM | |
3 | (NH4)2.SO4 | 200 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr15813_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLG -------110------- EDFTYSVEFEVYPEVEL ||||||||||||||||| EDFTYSVEFEVYPEVEL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
2 | GLN | CD | 180.551 |
9 | GLN | CD | 180.526 |
34 | ASN | CG | 175.753 |
52 | ASN | CG | 176.684 |
56 | GLN | CD | 179.982 |
64 | GLN | CD | 180.159 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 701 | 629 | 89.7 |
13C chemical shifts | 532 | 463 | 87.0 |
15N chemical shifts | 127 | 115 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 238 | 232 | 97.5 |
13C chemical shifts | 234 | 230 | 98.3 |
15N chemical shifts | 112 | 108 | 96.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 463 | 397 | 85.7 |
13C chemical shifts | 298 | 233 | 78.2 |
15N chemical shifts | 15 | 7 | 46.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 79 | 76 | 96.2 |
13C chemical shifts | 79 | 76 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 30 | 75.0 |
13C chemical shifts | 40 | 30 | 75.0 |