Solution structure of Oxidised ERp18
MHHHHHHMSD GHNGLGKGFG DHIHWRTLED GKKEAAASGL PLMVIIHKSW CGACKALKPK FAESTEISEL SHNFVMVNLE DEEEPKDEDF SPDGGYIPRI LFLDPSGKVH PEIINENGNP SYKYFYVSAE QVVQGMKEAQ ERLTGDAFRK KHLEDEL
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS51:SG | 1:CYS54:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.2 % (1632 of 1830) | 92.4 % (883 of 956) | 83.9 % (599 of 714) | 93.8 % (150 of 160) |
Backbone | 92.2 % (854 of 926) | 92.8 % (297 of 320) | 91.5 % (418 of 457) | 93.3 % (139 of 149) |
Sidechain | 87.2 % (913 of 1047) | 92.1 % (586 of 636) | 79.0 % (316 of 400) | 100.0 % (11 of 11) |
Aromatic | 58.4 % (104 of 178) | 85.4 % (76 of 89) | 29.9 % (26 of 87) | 100.0 % (2 of 2) |
Methyl | 100.0 % (132 of 132) | 100.0 % (66 of 66) | 100.0 % (66 of 66) |
1. ERp18
MHHHHHHMSD GHNGLGKGFG DHIHWRTLED GKKEAAASGL PLMVIIHKSW CGACKALKPK FAESTEISEL SHNFVMVNLE DEEEPKDEDF SPDGGYIPRI LFLDPSGKVH PEIINENGNP SYKYFYVSAE QVVQGMKEAQ ERLTGDAFRK KHLEDELSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ERp18 | [U-99% 15N] | 0.7-1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 % | |
4 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ERp18 | [U-99% 13C; U-99% 15N] | 1-1.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ERp18 | [U-99% 13C; U-99% 15N] | 0.7-1.5 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 % | |
12 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ERp18 | [U-99% 15N] | 0.7-1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ERp18 | [U-99% 13C; U-99% 15N] | 1-1.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ERp18 | [U-99% 13C; U-99% 15N] | 1-1.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ERp18 | [U-99% 13C; U-99% 15N] | 1-1.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ERp18 | [U-99% 13C; U-99% 15N] | 1-1.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ERp18 | [U-99% 13C; U-99% 15N] | 1-1.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ERp18 | [U-99% 13C; U-99% 15N] | 1-1.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ERp18 | [U-99% 13C; U-99% 15N] | 1-1.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ERp18 | [U-99% 13C; U-99% 15N] | 1-1.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ERp18 | [U-99% 13C; U-99% 15N] | 0.7-1.5 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 % | |
12 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz University of Kent; 5mm HCN z-pulse field gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ERp18 | [U-99% 15N] | 0.7-1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz NIMR, Mill Hill
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ERp18 | [U-99% 15N] | 0.7-1.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz NIMR, Mill Hill
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Sample Oxidised prior to concentration using 0.5 mM GSSG
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ERp18 | [U-99% 13C; U-99% 15N] | 1-1.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 % | |
8 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15964_2k8v.nef |
Input source #2: Coordindates | 2k8v.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:51:CYS:SG | A:54:CYS:SG | unknown | oxidized 2.9%, reduced 97.1%, CA 63.583, CB 33.572 ppm | 2.031 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHMSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MHHHHHHMSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRI -------110-------120-------130-------140-------150------- LFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 157 | 0 | 0 | 100.0 |
Content subtype: combined_15964_2k8v.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHMSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRI |||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| ......HMSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSW.GACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRI -------110-------120-------130-------140-------150------- LFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 714 | 589 | 82.5 |
1H chemical shifts | 956 | 884 | 92.5 |
15N chemical shifts | 164 | 149 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 314 | 280 | 89.2 |
1H chemical shifts | 320 | 300 | 93.8 |
15N chemical shifts | 149 | 138 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 400 | 309 | 77.2 |
1H chemical shifts | 636 | 584 | 91.8 |
15N chemical shifts | 15 | 11 | 73.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 71 | 66 | 93.0 |
1H chemical shifts | 71 | 69 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 87 | 23 | 26.4 |
1H chemical shifts | 89 | 77 | 86.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHMSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRI ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......MSD.HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150------- LFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL ||||||||||||||||||||||||||||||||||||||||||||||||||||| | LFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL..E -------110-------120-------130-------140-------150------
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHMSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRI | | |||||||||||| ||||||||| | || ||||||||||| |||| | || ||| ....................D.I.WRTLEDGKKEAA...LPLMVIIHK.....C..LK..FAESTEISELS..FVMV.L.........DF.......PRI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150------- LFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL |||| ||||| | | | ||||| |||||||||||||| | LFLD.SGKVH..I.N...N.SYKYF.VSAEQVVQGMKEAQ..L -------110-------120-------130-------140---
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHMSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRI ||||||||||||| ||||||||| ||||||||||||||||||||||||||||||||| ||||| |||||| ..........................TLEDGKKEAAASG.PLMVIIHKS.CGACKALKPKFAESTEISELSHNFVMVNLEDEE...DEDFS...GYIPRI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150------- LFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL |||| |||||| |||||||||||||||| LFLD..GKVHPE................AEQVVQGMKEAQERLT -------110-------120-------130-------140----