Solution NMR structure of integral membrane protein DsbB
MLRFLNQASQ GRGAWLLMAF TALALELTAL WFQHVMLLKP CVLSIYERAA LFGVLGAALI GAIAPKTPLR YVAMVIWLYS AFRGVQLTYE HTMLQLYPSP FATSDFMVRF PEWLPLDKWV PQVFVASGDC AERQWDFLGL EMPQWLLGIF IAYLIVAVLV VISQPFKAKK RDLFGRGHHH HHH
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS41:SG | 1:CYS130:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 40.3 % (905 of 2247) | 18.9 % (218 of 1152) | 56.7 % (513 of 905) | 91.6 % (174 of 190) |
Backbone | 79.4 % (856 of 1078) | 49.9 % (183 of 367) | 94.1 % (506 of 538) | 96.5 % (167 of 173) |
Sidechain | 15.7 % (210 of 1341) | 4.5 % (35 of 785) | 31.2 % (168 of 539) | 41.2 % (7 of 17) |
Aromatic | 4.8 % (14 of 294) | 4.8 % (7 of 147) | 0.0 % (0 of 140) | 100.0 % (7 of 7) |
Methyl | 14.7 % (37 of 252) | 8.7 % (11 of 126) | 20.6 % (26 of 126) |
1. Disulfide bond formation protein B
MLRFLNQASQ GRGAWLLMAF TALALELTAL WFQHVMLLKP CVLSIYERAA LFGVLGAALI GAIAPKTPLR YVAMVIWLYS AFRGVQLTYE HTMLQLYPSP FATSDFMVRF PEWLPLDKWV PQVFVASGDC AERQWDFLGL EMPQWLLGIF IAYLIVAVLV VISQPFKAKK RDLFGRGHHH HHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsbB[CSSC] | [U-13C; U-15N; U-2H] | 1.2 mM | |
2 | DPC | [U-2H] | 100 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 50 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DsbB[CSSC] | I,L,V methyl protonated, [U-13C; U-15N; U-2H] | 1.5 mM | |
6 | DPC | [U-2H] | 100 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | potassium chloride | natural abundance | 50 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2, Details single Cys mutants to incorporate MTSL/dMTSL for PRE measurements
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | DsbB[CSSC] single Cys mutants | [U-15N; U-2H] | 0.5 ~ 1.0 mM | |
10 | DPC | natural abundance | 100 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsbB[CSSC] | [U-13C; U-15N; U-2H] | 1.2 mM | |
2 | DPC | [U-2H] | 100 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsbB[CSSC] | [U-13C; U-15N; U-2H] | 1.2 mM | |
2 | DPC | [U-2H] | 100 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsbB[CSSC] | [U-13C; U-15N; U-2H] | 1.2 mM | |
2 | DPC | [U-2H] | 100 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsbB[CSSC] | [U-13C; U-15N; U-2H] | 1.2 mM | |
2 | DPC | [U-2H] | 100 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsbB[CSSC] | [U-13C; U-15N; U-2H] | 1.2 mM | |
2 | DPC | [U-2H] | 100 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsbB[CSSC] | [U-13C; U-15N; U-2H] | 1.2 mM | |
2 | DPC | [U-2H] | 100 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsbB[CSSC] | [U-13C; U-15N; U-2H] | 1.2 mM | |
2 | DPC | [U-2H] | 100 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DsbB[CSSC] | I,L,V methyl protonated, [U-13C; U-15N; U-2H] | 1.5 mM | |
6 | DPC | [U-2H] | 100 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DsbB[CSSC] | I,L,V methyl protonated, [U-13C; U-15N; U-2H] | 1.5 mM | |
6 | DPC | [U-2H] | 100 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DsbB[CSSC] | I,L,V methyl protonated, [U-13C; U-15N; U-2H] | 1.5 mM | |
6 | DPC | [U-2H] | 100 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DsbB[CSSC] | I,L,V methyl protonated, [U-13C; U-15N; U-2H] | 1.5 mM | |
6 | DPC | [U-2H] | 100 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DsbB[CSSC] | I,L,V methyl protonated, [U-13C; U-15N; U-2H] | 1.5 mM | |
6 | DPC | [U-2H] | 100 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.2, Details single Cys mutants to incorporate MTSL/dMTSL for PRE measurements
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | DsbB[CSSC] single Cys mutants | [U-15N; U-2H] | 0.5 ~ 1.0 mM | |
10 | DPC | natural abundance | 100 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | potassium chloride | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15966_2k73.nef |
Input source #2: Coordindates | 2k73.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:41:CYS:SG | A:130:CYS:SG | oxidized, CA 56.18, CB 50.684 ppm | oxidized, CA 54.992, CB 38.294 ppm | 2.02 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLSIYERAALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLSIYERAALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSP -------110-------120-------130-------140-------150-------160-------170-------180--- FATSDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGRGHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FATSDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGRGHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 183 | 0 | 0 | 100.0 |
Content subtype: combined_15966_2k73.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLSIYERAALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLSIYERAALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180--- FATSDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGRGHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||| FATSDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAK..DLFGR -------110-------120-------130-------140-------150-------160-------170------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1152 | 169 | 14.7 |
13C chemical shifts | 905 | 499 | 55.1 |
15N chemical shifts | 199 | 170 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 367 | 162 | 44.1 |
13C chemical shifts | 366 | 341 | 93.2 |
15N chemical shifts | 173 | 163 | 94.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 785 | 7 | 0.9 |
13C chemical shifts | 539 | 158 | 29.3 |
15N chemical shifts | 26 | 7 | 26.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 133 | 0 | 0.0 |
13C chemical shifts | 133 | 20 | 15.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 147 | 7 | 4.8 |
13C chemical shifts | 140 | 0 | 0.0 |
15N chemical shifts | 7 | 7 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLSIYERAALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSP |||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||| || ||||||||||||||||||||||||||||| | .LRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLK..VLSIYERAALFGVLGAALIGAIA.KT.LRYVAMVIWLYSAFRGVQLTYEHTMLQLY.S. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180--- FATSDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGRGHHHHHH ||||| ||| ||||| ||||||||||| ||||||||| ||||||||||||||||||||| | .....FMVRF.EWL.LDKWV.QVFVASGDCAE.QWDFLGLEM.QWLLGIFIAYLIVAVLVVISQ.F -------110-------120-------130-------140-------150-------160------
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLSIYERAALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSP || |||||||||||||||||||||||||||||||||| |||||||||||||||||||||| ||||||||||||||||||||||||||||||| ML.FLNQASQGRGAWLLMAFTALALELTALWFQHVML...CVLSIYERAALFGVLGAALIGA....TPLRYVAMVIWLYSAFRGVQLTYEHTMLQLY... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180--- FATSDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGRGHHHHHH | | | | | ||||||||||||||||||||||||| ..............P...W.P...V...........F..LEMPQWLLGIFIAYLIVAVLVVISQ -------110-------120-------130-------140-------150-------160----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLSIYERAALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLSIYERAALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYP.. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180--- FATSDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGRGHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......VRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQ -------110-------120-------130-------140-------150-------160----
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLSIYERAALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSP |||||||||||||||||| |||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..RFLNQASQGRGAWLLMAF..LALELTALWFQH.MLLKPCVLSIYERAALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYP.. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180--- FATSDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGRGHHHHHH ||||||||||||||||||||||||||||||||||||||||| |||||||| ............WLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAY.IVAVLVVI -------110-------120-------130-------140-------150-------160--