NMR solution structure of an uncharacterized protein from Chlorobium tepidum. Northeast Structural Genomics target CtR107
MDFECQFVCE LKELAPVPAL LIRTQTAMSE LGSLFEAGYH DILQLLAGQG KSPSGPPFAR YFGMSAGTFE VEFGFPVEGG VEGSGRVVTG LTPSGKAASS LYIGPYGEIE AVYDALMKWV DDNGFDLSGE AYEIYLDNPA ETAPDQLRTR VSLMLHESLE HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.5 % (1592 of 1863) | 93.0 % (889 of 956) | 73.9 % (549 of 743) | 93.9 % (154 of 164) |
Backbone | 82.7 % (807 of 976) | 95.0 % (323 of 340) | 70.0 % (336 of 480) | 94.9 % (148 of 156) |
Sidechain | 88.0 % (911 of 1035) | 90.7 % (559 of 616) | 84.2 % (346 of 411) | 75.0 % (6 of 8) |
Aromatic | 75.8 % (144 of 190) | 91.6 % (87 of 95) | 59.6 % (56 of 94) | 100.0 % (1 of 1) |
Methyl | 92.5 % (161 of 174) | 92.0 % (80 of 87) | 93.1 % (81 of 87) |
1. CtR107
MDFECQFVCE LKELAPVPAL LIRTQTAMSE LGSLFEAGYH DILQLLAGQG KSPSGPPFAR YFGMSAGTFE VEFGFPVEGG VEGSGRVVTG LTPSGKAASS LYIGPYGEIE AVYDALMKWV DDNGFDLSGE AYEIYLDNPA ETAPDQLRTR VSLMLHESLE HHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CtR107 | [U-99% 13C; U-99% 15N] | 0.45 mM | |
2 | D2O | [U-2H] | 5 % | |
3 | H2O | natural abundance | 95 % | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | MES | natural abundance | 20 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | CtR107 | [U-5% 13C; U-99% 15N] | 0.45 mM | |
11 | D2O | [U-2H] | 5 % | |
12 | H2O | natural abundance | 95 % | |
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | MES | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CtR107 | [U-99% 13C; U-99% 15N] | 0.45 mM | |
2 | D2O | [U-2H] | 5 % | |
3 | H2O | natural abundance | 95 % | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CtR107 | [U-99% 13C; U-99% 15N] | 0.45 mM | |
2 | D2O | [U-2H] | 5 % | |
3 | H2O | natural abundance | 95 % | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CtR107 | [U-99% 13C; U-99% 15N] | 0.45 mM | |
2 | D2O | [U-2H] | 5 % | |
3 | H2O | natural abundance | 95 % | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CtR107 | [U-99% 13C; U-99% 15N] | 0.45 mM | |
2 | D2O | [U-2H] | 5 % | |
3 | H2O | natural abundance | 95 % | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CtR107 | [U-99% 13C; U-99% 15N] | 0.45 mM | |
2 | D2O | [U-2H] | 5 % | |
3 | H2O | natural abundance | 95 % | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CtR107 | [U-99% 13C; U-99% 15N] | 0.45 mM | |
2 | D2O | [U-2H] | 5 % | |
3 | H2O | natural abundance | 95 % | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CtR107 | [U-99% 13C; U-99% 15N] | 0.45 mM | |
2 | D2O | [U-2H] | 5 % | |
3 | H2O | natural abundance | 95 % | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CtR107 | [U-99% 13C; U-99% 15N] | 0.45 mM | |
2 | D2O | [U-2H] | 5 % | |
3 | H2O | natural abundance | 95 % | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | CtR107 | [U-5% 13C; U-99% 15N] | 0.45 mM | |
11 | D2O | [U-2H] | 5 % | |
12 | H2O | natural abundance | 95 % | |
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | CtR107 | [U-5% 13C; U-99% 15N] | 0.45 mM | |
11 | D2O | [U-2H] | 5 % | |
12 | H2O | natural abundance | 95 % | |
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | MES | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16097_2kcu.nef |
Input source #2: Coordindates | 2kcu.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDFECQFVCELKELAPVPALLIRTQTAMSELGSLFEAGYHDILQLLAGQGKSPSGPPFARYFGMSAGTFEVEFGFPVEGGVEGSGRVVTGLTPSGKAASS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDFECQFVCELKELAPVPALLIRTQTAMSELGSLFEAGYHDILQLLAGQGKSPSGPPFARYFGMSAGTFEVEFGFPVEGGVEGSGRVVTGLTPSGKAASS -------110-------120-------130-------140-------150-------160------ LYIGPYGEIEAVYDALMKWVDDNGFDLSGEAYEIYLDNPAETAPDQLRTRVSLMLHESLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LYIGPYGEIEAVYDALMKWVDDNGFDLSGEAYEIYLDNPAETAPDQLRTRVSLMLHESLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 166 | 0 | 0 | 100.0 |
Content subtype: combined_16097_2kcu.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDFECQFVCELKELAPVPALLIRTQTAMSELGSLFEAGYHDILQLLAGQGKSPSGPPFARYFGMSAGTFEVEFGFPVEGGVEGSGRVVTGLTPSGKAASS |||||||||||||||||||||||||||||||||||||||||| |||||||||||| |||||||||||||||||||||||||||||||||||||||||||| MDFECQFVCELKELAPVPALLIRTQTAMSELGSLFEAGYHDI.QLLAGQGKSPSG.PFARYFGMSAGTFEVEFGFPVEGGVEGSGRVVTGLTPSGKAASS -------110-------120-------130-------140-------150-------160------ LYIGPYGEIEAVYDALMKWVDDNGFDLSGEAYEIYLDNPAETAPDQLRTRVSLMLHESLEHHHHHH |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LYIG.YGEIEAVYDALMKWVDDNGFDLSGEAYEIYLDNPAETAPDQLRTRVSLMLHESLEHHHHHH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 956 | 864 | 90.4 |
13C chemical shifts | 743 | 488 | 65.7 |
15N chemical shifts | 169 | 155 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 340 | 324 | 95.3 |
13C chemical shifts | 332 | 156 | 47.0 |
15N chemical shifts | 156 | 149 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 616 | 540 | 87.7 |
13C chemical shifts | 411 | 332 | 80.8 |
15N chemical shifts | 13 | 6 | 46.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 92 | 85 | 92.4 |
13C chemical shifts | 92 | 85 | 92.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 95 | 86 | 90.5 |
13C chemical shifts | 94 | 53 | 56.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDFECQFVCELKELAPVPALLIRTQTAMSELGSLFEAGYHDILQLLAGQGKSPSGPPFARYFGMSAGTFEVEFGFPVEGGVEGSGRVVTGLTPSGKAASS ||||||||||||||||||||||||||||||||||||||||| |||||||||||| |||||| | ||||||| |||||||||||||||||||||||||| .DFECQFVCELKELAPVPALLIRTQTAMSELGSLFEAGYHDI.QLLAGQGKSPSG.PFARYF.M..GTFEVEF.FPVEGGVEGSGRVVTGLTPSGKAASS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160------ LYIGPYGEIEAVYDALMKWVDDNGFDLSGEAYEIYLDNPAETAPDQLRTRVSLMLHESLEHHHHHH |||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||| LYIG.Y.EIEAVYDALMKWVDDNGFDLSGEAYEIYLDNPAETAPDQLRTRVSLMLHESLEH -------110-------120-------130-------140-------150-------160-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDFECQFVCELKELAPVPALLIRTQTAMSELGSLFEAGYHDILQLLAGQGKSPSGPPFARYFGMSAGTFEVEFGFPVEGGVEGSGRVVTGLTPSGKAASS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDFECQFVCELKELAPVPALLIRTQTAMSELGSLFEAGYHDILQLLAGQGKSPSGPPFARYFGMSAGTFEVEFGFPVEGGVEGSGRVVTGLTPSGKAASS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160------ LYIGPYGEIEAVYDALMKWVDDNGFDLSGEAYEIYLDNPAETAPDQLRTRVSLMLHESLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LYIGPYGEIEAVYDALMKWVDDNGFDLSGEAYEIYLDNPAETAPDQLRTRVSLMLHESL -------110-------120-------130-------140-------150---------