NMR structures of GA95 and GB95, two designed proteins with 95% sequence identity but different folds and functions
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.5 % (604 of 675) | 86.5 % (300 of 347) | 91.4 % (245 of 268) | 98.3 % (59 of 60) |
Backbone | 98.8 % (332 of 336) | 99.1 % (113 of 114) | 98.8 % (164 of 166) | 98.2 % (55 of 56) |
Sidechain | 83.0 % (326 of 393) | 80.3 % (187 of 233) | 86.5 % (135 of 156) | 100.0 % (4 of 4) |
Aromatic | 82.1 % (46 of 56) | 82.1 % (23 of 28) | 81.5 % (22 of 27) | 100.0 % (1 of 1) |
Methyl | 80.8 % (63 of 78) | 82.1 % (32 of 39) | 79.5 % (31 of 39) |
1. entity
TTYKLILNLK QAKEEAIKEA VDAGTAEKYF KLIANAKTVE GVWTYKDEIK TFTVTESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.1) K, pH 7.2 (±0.1), Details 0.15~0.3 mM Gb95 protein + pH7.2 100 mM potassium phosphate + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gb95 | [U-100% 13C; U-100% 15N] | 0.15-0.3 mM | |
2 | potassium phosphate pH 7.2 | natural abundance | 100 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16117_2kdm.nef |
Input source #2: Coordindates | 2kdm.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE |||||||||||||||||||||||||||||||||||||||||||||||||||||||| TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 56 | 0 | 0 | 100.0 |
Content subtype: combined_16117_2kdm.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE |||||||||||||||||||||||||||||||||||||||||||||||||||||||| TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 347 | 292 | 84.1 |
13C chemical shifts | 268 | 242 | 90.3 |
15N chemical shifts | 60 | 59 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 114 | 113 | 99.1 |
13C chemical shifts | 112 | 110 | 98.2 |
15N chemical shifts | 56 | 55 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 233 | 179 | 76.8 |
13C chemical shifts | 156 | 132 | 84.6 |
15N chemical shifts | 4 | 4 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 31 | 79.5 |
13C chemical shifts | 39 | 30 | 76.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 21 | 75.0 |
13C chemical shifts | 27 | 20 | 74.1 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE |||||||||||||||||||||||||||||||||||||||||||||||||||||||| TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE | |||||| | | | | |||||||||||||||| | | | ||||||| T.YKLILN.....E.A.K.A..AGTAEKYFKLIANAKT...V.T.K...KTFTVTE
Dihedral angle restraints
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE |||||||| |||||||||||||||||||||||||| ||||||| ||||||| ..YKLILNLK.AKEEAIKEAVDAGTAEKYFKLIANAK...GVWTYKD..KTFTVTE