Solution NMR structure of the monomeric W187R mutant of A/Udorn NS1 effector domain. Northeast Structural Genomics target OR8C[W187R].
MPASRYITDM TIEELSRDWF MLMPKQKVEG PLCIRIDQAI MDKNIMLKAN FSVIFDRLET LILLRAFTEE GAIVGEISPL PSFPGHTIED VKNAIGVLIG GLERNDNTVR VSKTLQRFAW GSSNENGRPP LTLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.7 % (1553 of 1657) | 94.1 % (812 of 863) | 93.1 % (605 of 650) | 94.4 % (136 of 144) |
Backbone | 94.1 % (775 of 824) | 95.4 % (268 of 281) | 93.2 % (383 of 411) | 93.9 % (124 of 132) |
Sidechain | 93.4 % (900 of 964) | 93.5 % (544 of 582) | 93.0 % (344 of 370) | 100.0 % (12 of 12) |
Aromatic | 77.5 % (93 of 120) | 78.3 % (47 of 60) | 75.9 % (44 of 58) | 100.0 % (2 of 2) |
Methyl | 100.0 % (166 of 166) | 100.0 % (83 of 83) | 100.0 % (83 of 83) |
1. OR8w187r
MPASRYITDM TIEELSRDWF MLMPKQKVEG PLCIRIDQAI MDKNIMLKAN FSVIFDRLET LILLRAFTEE GAIVGEISPL PSFPGHTIED VKNAIGVLIG GLERNDNTVR VSKTLQRFAW GSSNENGRPP LTLEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | OR8w187r | [U-5% 13C; U-100% 15N] | 1.2 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | arginine | natural abundance | 50 mM | |
12 | glutamic acid | natural abundance | 50 mM | |
13 | glycerol | natural abundance | 1 % | |
14 | DSS | natural abundance | 50 uM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | OR8w187r | [U-5% 13C; U-100% 15N] | 1.2 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | arginine | natural abundance | 50 mM | |
12 | glutamic acid | natural abundance | 50 mM | |
13 | glycerol | natural abundance | 1 % | |
14 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | OR8w187r | [U-5% 13C; U-100% 15N] | 1.2 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | arginine | natural abundance | 50 mM | |
12 | glutamic acid | natural abundance | 50 mM | |
13 | glycerol | natural abundance | 1 % | |
14 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | OR8w187r | [U-5% 13C; U-100% 15N] | 1.2 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | arginine | natural abundance | 50 mM | |
12 | glutamic acid | natural abundance | 50 mM | |
13 | glycerol | natural abundance | 1 % | |
14 | DSS | natural abundance | 50 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR8w187r | [U-100% 13C; U-100% 15N] | 0.71 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | arginine | natural abundance | 50 mM | |
5 | glutamic acid | natural abundance | 50 mM | |
6 | glycerol | natural abundance | 1 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 300 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | OR8w187r | [U-5% 13C; U-100% 15N] | 1.2 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | arginine | natural abundance | 50 mM | |
12 | glutamic acid | natural abundance | 50 mM | |
13 | glycerol | natural abundance | 1 % | |
14 | DSS | natural abundance | 50 uM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16376_2kkz.nef |
Input source #2: Coordindates | 2kkz.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----90-------100-------110-------120-------130-------140-------150-------160-------170-------180--- MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ----190-------200-------210-------220--- GLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLEHHHHHH |||||||||||||||||||||||||||||||||||||||| GLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLEHHHHHH -------110-------120-------130-------140
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 140 | 0 | 0 | 100.0 |
Content subtype: combined_16376_2kkz.nef
Assigned chemical shifts
-----90-------100-------110-------120-------130-------140-------150-------160-------170-------180--- MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIG -----90-------100-------110-------120-------130-------140-------150-------160-------170-------180--- ----190-------200-------210-------220--- GLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLEHHHHHH |||||||||||||||||||||||||||||||||| GLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLE ----190-------200-------210-------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
109 | GLN | CD | 179.758 |
121 | GLN | CD | 180.402 |
127 | ASN | CG | 176.995 |
133 | ASN | CG | 175.142 |
169 | HIS | ND1 | 171.89 |
169 | HIS | NE2 | 253.92 |
176 | ASN | CG | 175.562 |
188 | ASN | CG | 176.791 |
199 | GLN | CD | 179.589 |
207 | ASN | CG | 177.094 |
209 | ASN | CG | 177.094 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 863 | 810 | 93.9 |
13C chemical shifts | 650 | 605 | 93.1 |
15N chemical shifts | 153 | 137 | 89.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 281 | 266 | 94.7 |
13C chemical shifts | 280 | 261 | 93.2 |
15N chemical shifts | 132 | 123 | 93.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 582 | 544 | 93.5 |
13C chemical shifts | 370 | 344 | 93.0 |
15N chemical shifts | 21 | 14 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 89 | 100.0 |
13C chemical shifts | 89 | 89 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 47 | 78.3 |
13C chemical shifts | 58 | 44 | 75.9 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-----90-------100-------110-------120-------130-------140-------150-------160-------170-------180--- MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIG -----90-------100-------110-------120-------130-------140-------150-------160-------170-------180--- ----190-------200-------210-------220--- GLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLEHHHHHH |||||||||||||||||||||||||||||||||| GLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLE ----190-------200-------210-------
Dihedral angle restraints
-----90-------100-------110-------120-------130-------140-------150-------160-------170-------180--- MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...SRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIG -----90-------100-------110-------120-------130-------140-------150-------160-------170-------180--- ----190-------200-------210-------220--- GLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLEHHHHHH |||||||||||||||||||| GLERNDNTVRVSKTLQRFAW ----190-------200---
RDC restraints
-----90-------100-------110-------120-------130-------140-------150-------160-------170-------180--- MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIG | | |||||||| || ||| || | | | || ||||| |||| || | | |||||||| | ||||| | |||||||| ||||| ....R..T.MTIEELSR.WF....KQK.EG.L.I...Q.IM.KNIML.ANFS.IF.R.E...LLRAFTEE.A.VGEIS....F..HTIEDVKN..GVLIG -----90-------100-------110-------120-------130-------140-------150-------160-------170-------180--- ----190-------200-------210-------220--- GLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLEHHHHHH | || ||| || |||| ..E.ND..VRV..TL.RFAW ----190-------200---