The Structure of Anti-TRAP
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.8 % (548 of 572) | 94.6 % (279 of 295) | 96.4 % (217 of 225) | 100.0 % (52 of 52) |
Backbone | 98.7 % (302 of 306) | 100.0 % (106 of 106) | 97.4 % (147 of 151) | 100.0 % (49 of 49) |
Sidechain | 93.6 % (293 of 313) | 91.5 % (173 of 189) | 96.7 % (117 of 121) | 100.0 % (3 of 3) |
Aromatic | 63.6 % (14 of 22) | 63.6 % (7 of 11) | 63.6 % (7 of 11) | |
Methyl | 100.0 % (66 of 66) | 100.0 % (33 of 33) | 100.0 % (33 of 33) |
1. Anti-TRAP
XVIATDDLEV ACPKCERAGE IEGTPCPACS GKGVILTAQG YTLLDFIQKH LNKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | beta-mercaptoethanol | natural abundance | 20 mM | |
10 | ZnCl2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | beta-mercaptoethanol | natural abundance | 20 mM | |
10 | ZnCl2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | beta-mercaptoethanol | natural abundance | 20 mM | |
10 | ZnCl2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | beta-mercaptoethanol | natural abundance | 20 mM | |
10 | ZnCl2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | beta-mercaptoethanol | natural abundance | 20 mM | |
10 | ZnCl2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | beta-mercaptoethanol | natural abundance | 20 mM | |
10 | ZnCl2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 328 K, pH 7.5, Details pH 7.5 at RT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 5.0 ~ 10.0 mM | |
2 | TRIS | [U-2H] | 20 mM | |
3 | beta-mercaptoethanol | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16492_2ko8.nef |
Input source #2: Coordindates | 2ko8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:1:FME:C | 1:2:VAL:N | unknown | unknown | n/a |
2:1:FME:C | 2:2:VAL:N | unknown | unknown | n/a |
3:1:FME:C | 3:2:VAL:N | unknown | unknown | n/a |
1:12:CYS:SG | 4:1:ZN:ZN | unknown | unknown | n/a |
1:15:CYS:SG | 4:1:ZN:ZN | unknown | unknown | n/a |
1:26:CYS:SG | 4:1:ZN:ZN | unknown | unknown | n/a |
1:29:CYS:SG | 4:1:ZN:ZN | unknown | unknown | n/a |
2:12:CYS:SG | 4:2:ZN:ZN | unknown | unknown | n/a |
2:15:CYS:SG | 4:2:ZN:ZN | unknown | unknown | n/a |
2:26:CYS:SG | 4:2:ZN:ZN | unknown | unknown | n/a |
2:29:CYS:SG | 4:2:ZN:ZN | unknown | unknown | n/a |
3:12:CYS:SG | 4:3:ZN:ZN | unknown | unknown | n/a |
3:15:CYS:SG | 4:3:ZN:ZN | unknown | unknown | n/a |
3:26:CYS:SG | 4:3:ZN:ZN | unknown | unknown | n/a |
3:29:CYS:SG | 4:3:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
A | 1 | FME | N-FORMYLMETHIONINE | Assigned chemical shifts, Distance restraints, Torsion angle restraints, Coordinates |
B | 1 | FME | N-FORMYLMETHIONINE | Distance restraints, Torsion angle restraints, Coordinates |
C | 1 | FME | N-FORMYLMETHIONINE | Distance restraints, Torsion angle restraints, Coordinates |
D | 1 | ZN | ZINC ION | None |
D | 2 | ZN | ZINC ION | None |
D | 3 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 53 | 0 | 0 | 100.0 |
B | B | 53 | 0 | 0 | 100.0 |
C | C | 53 | 0 | 0 | 100.0 |
Content subtype: combined_16492_2ko8.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
Comp_index_ID | Comp_ID |
---|---|
1 | FME |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 295 | 279 | 94.6 |
13C chemical shifts | 225 | 217 | 96.4 |
15N chemical shifts | 53 | 52 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 106 | 106 | 100.0 |
13C chemical shifts | 104 | 100 | 96.2 |
15N chemical shifts | 49 | 49 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 189 | 173 | 91.5 |
13C chemical shifts | 121 | 117 | 96.7 |
15N chemical shifts | 4 | 3 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 33 | 100.0 |
13C chemical shifts | 33 | 33 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 11 | 7 | 63.6 |
13C chemical shifts | 11 | 7 | 63.6 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
Dihedral angle restraints
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK ||||||||||||||||||||||||||||||||||||||||||||||||||||| XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
RDC restraints
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK || || |||| ||||||||||| | |||||||||| ||||||||||||| ..IA.DD.EVAC.KCERAGEIEGT.C.ACSGKGVILT.QGYTLLDFIQKHL --------10--------20--------30--------40--------50-
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK || || |||| ||||||||||| | |||||||||| ||||||||||||| ..IA.DD.EVAC.KCERAGEIEGT.C.ACSGKGVILT.QGYTLLDFIQKHL --------10--------20--------30--------40--------50-
--------10--------20--------30--------40--------50--- XVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK || || |||| ||||||||||| | |||||||||| ||||||||||||| ..IA.DD.EVAC.KCERAGEIEGT.C.ACSGKGVILT.QGYTLLDFIQKHL --------10--------20--------30--------40--------50-