Solution NMR structure of a Bacterial Ig-like (Big_3) domain from Bacillus cereus. Northeast Structural Genomics Consortium target BcR147A.
MGNGETSDLE PKLTVPVGAT IHVGDSFVPM AEVLAIDKED GDLTSKIKVD GEVDTTKAGT YVLTYTVTDS KGHEVTAKQT VTVKVREEVK NDKPILEHHH HHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.4 % (1051 of 1138) | 92.3 % (536 of 581) | 92.5 % (421 of 455) | 92.2 % (94 of 102) |
Backbone | 92.6 % (565 of 610) | 91.9 % (193 of 210) | 93.4 % (281 of 301) | 91.9 % (91 of 99) |
Sidechain | 92.3 % (575 of 623) | 92.5 % (343 of 371) | 92.0 % (229 of 249) | 100.0 % (3 of 3) |
Aromatic | 55.2 % (32 of 58) | 55.2 % (16 of 29) | 55.2 % (16 of 29) | |
Methyl | 99.2 % (131 of 132) | 98.5 % (65 of 66) | 100.0 % (66 of 66) |
1. BcR147A
MGNGETSDLE PKLTVPVGAT IHVGDSFVPM AEVLAIDKED GDLTSKIKVD GEVDTTKAGT YVLTYTVTDS KGHEVTAKQT VTVKVREEVK NDKPILEHHH HHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | BcR147A | [U-5% 13C; U-100% 15N] | 0.78 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | BcR147A | [U-5% 13C; U-100% 15N] | 0.78 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | BcR147A | [U-5% 13C; U-100% 15N] | 0.78 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BcR147A | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16561_2kpn.nef |
Input source #2: Coordindates | 2kpn.cif |
Diamagnetism of the molecular assembly | False (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:39:GLU:OE1 | 2:1:CA:CA | unknown | unknown | n/a |
1:69:ASP:OD2 | 2:1:CA:CA | unknown | unknown | n/a |
1:37:ASP:OD1 | 2:1:CA:CA | unknown | unknown | n/a |
1:8:ASP:OD2 | 2:1:CA:CA | unknown | unknown | n/a |
1:8:ASP:OD1 | 2:1:CA:CA | unknown | unknown | n/a |
1:37:ASP:OD2 | 2:1:CA:CA | unknown | unknown | n/a |
1:9:LEU:O | 2:1:CA:CA | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | CA | CALCIUM ION | None |
Sequence alignments
---660-----670-------680-------690-------700-------710-------720-------730-------740-------750------ MGNGETSDLEPKLTVPVGATIHVGDSFVPMAEVLAIDKEDGDLTSKIKVDGEVDTTKAGTYVLTYTVTDSKGHEVTAKQTVTVKVREEVKNDKPILEHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGNGETSDLEPKLTVPVGATIHVGDSFVPMAEVLAIDKEDGDLTSKIKVDGEVDTTKAGTYVLTYTVTDSKGHEVTAKQTVTVKVREEVKNDKPILEHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --- HHH ||| HHH ---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 103 | 0 | 0 | 100.0 |
Content subtype: combined_16561_2kpn.nef
Assigned chemical shifts
---660-----670-------680-------690-------700-------710-------720-------730-------740-------750------ MGNGETSDLEPKLTVPVGATIHVGDSFVPMAEVLAIDKEDGDLTSKIKVDGEVDTTKAGTYVLTYTVTDSKGHEVTAKQTVTVKVREEVKNDKPILEHHH | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| M.NGETSDLEPKLTVPVGATIHVGDSFVPMAEVLAIDKEDGDLTSKIKVDGEVDTTKAGTYVLTYTVTDSKGHEVTAKQTVTVKVREEVKNDKPILE ---660-----670-------680-------690-------700-------710-------720-------730-------740-------750--- --- HHH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
659 | ASN | CG | 177.172 |
721 | TYR | HH | 9.034 |
735 | GLN | CD | 176.84 |
747 | ASN | CG | 177.078 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 581 | 536 | 92.3 |
13C chemical shifts | 455 | 419 | 92.1 |
15N chemical shifts | 103 | 94 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 210 | 191 | 91.0 |
13C chemical shifts | 206 | 190 | 92.2 |
15N chemical shifts | 99 | 90 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 371 | 345 | 93.0 |
13C chemical shifts | 249 | 229 | 92.0 |
15N chemical shifts | 4 | 4 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 67 | 98.5 |
13C chemical shifts | 68 | 67 | 98.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 29 | 16 | 55.2 |
13C chemical shifts | 29 | 16 | 55.2 |
Covalent bonds
Distance restraints
---660-----670-------680-------690-------700-------710-------720-------730-------740-------750------ MGNGETSDLEPKLTVPVGATIHVGDSFVPMAEVLAIDKEDGDLTSKIKVDGEVDTTKAGTYVLTYTVTDSKGHEVTAKQTVTVKVREEVKNDKPILEHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....ETSDLEPKLTVPVGATIHVGDSFVPMAEVLAIDKEDGDLTSKIKVDGEVDTTKAGTYVLTYTVTDSKGHEVTAKQTVTVKVREEVKNDKPILE ---660-----670-------680-------690-------700-------710-------720-------730-------740-------750--- --- HHH
Dihedral angle restraints
---660-----670-------680-------690-------700-------710-------720-------730-------740-------750------ MGNGETSDLEPKLTVPVGATIHVGDSFVPMAEVLAIDKEDGDLTSKIKVDGEVDTTKAGTYVLTYTVTDSKGHEVTAKQTVTVKVREEVKNDKPILEHHH |||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......SDLEPKLTVPVGATIHVG.SFVPMAEVLAIDKEDGDLTSKIKVDGEVDTTKAGTYVLTYTVTDSKGHEVTAKQTVTVKVR ---660-----670-------680-------690-------700-------710-------720-------730-------740-- --- HHH