SOLUTION NMR STRUCTURE OF DE NOVO DESIGNED ROSSMANN 2x2 FOLD PROTEIN, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET OR16
MLLYVLIISN DKKLIEEARK MAEKANLELR TVKTEDELKK YLEEFRKESQ NIKVLILVSN DEELDKAKEL AQKMEIDVRT RKVTSPDEAK RWIKEFSEEG GSLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.7 % (1299 of 1358) | 96.1 % (690 of 718) | 95.2 % (499 of 524) | 94.8 % (110 of 116) |
Backbone | 95.3 % (627 of 658) | 95.0 % (210 of 221) | 95.7 % (314 of 328) | 94.5 % (103 of 109) |
Sidechain | 96.2 % (777 of 808) | 96.6 % (480 of 497) | 95.4 % (290 of 304) | 100.0 % (7 of 7) |
Aromatic | 70.8 % (51 of 72) | 72.2 % (26 of 36) | 68.6 % (24 of 35) | 100.0 % (1 of 1) |
Methyl | 100.0 % (124 of 124) | 100.0 % (62 of 62) | 100.0 % (62 of 62) |
1. 2x2
MLLYVLIISN DKKLIEEARK MAEKANLELR TVKTEDELKK YLEEFRKESQ NIKVLILVSN DEELDKAKEL AQKMEIDVRT RKVTSPDEAK RWIKEFSEEG GSLEHHHHHHSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.859 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaCl | natural abundance | 200 mM |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-10% 13C; U-100% 15N] | 0.867 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % | |
8 | NaCl | natural abundance | 200 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.859 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaCl | natural abundance | 200 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-10% 13C; U-100% 15N] | 0.867 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % | |
8 | NaCl | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.859 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaCl | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.859 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaCl | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.859 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaCl | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.859 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaCl | natural abundance | 200 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.859 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaCl | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.859 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaCl | natural abundance | 200 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-10% 13C; U-100% 15N] | 0.867 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % | |
8 | NaCl | natural abundance | 200 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.859 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaCl | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NMR 6.5-200 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.859 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaCl | natural abundance | 200 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16562_2kpo.nef |
Input source #2: Coordindates | 2kpo.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEG -------110 GSLEHHHHHH |||||||||| GSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 110 | 0 | 0 | 100.0 |
Content subtype: combined_16562_2kpo.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 GSLEHHHHHH |||||| GSLEHH ------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
9 | SER | HG | 6.06 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 718 | 687 | 95.7 |
13C chemical shifts | 524 | 497 | 94.8 |
15N chemical shifts | 122 | 115 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 221 | 211 | 95.5 |
13C chemical shifts | 220 | 209 | 95.0 |
15N chemical shifts | 109 | 103 | 94.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 497 | 476 | 95.8 |
13C chemical shifts | 304 | 288 | 94.7 |
15N chemical shifts | 13 | 12 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 65 | 100.0 |
13C chemical shifts | 65 | 65 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 24 | 66.7 |
13C chemical shifts | 35 | 23 | 65.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 GSLEHHHHHH |||| GSLE ----
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEG | ||||| || || ||||| | | | |||||||| | | |||||| ||||||||||| ||| | | | | ||||||||||| .L.YVLII..DK..IE.ARKMA..A....R.V...DELKKYLE..R....N.KVLILV.NDEELDKAKEL.QKM....R.R.V..P.EAKRWIKEFSE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------- -------110 GSLEHHHHHH
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEG |||||||||| |||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| ||||||||||||||| MLLYVLIISN.KKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRK...NIKVLILVSNDEELDKAKELAQKMEIDVRTRKVT.PDEAKRWIKEFSEEG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 GSLEHHHHHH