Solution Structure of extended PDZ2 Domain from NHERF1 (150-270)
GIDPFTMLRP RLCTMKKGPS GYGFNLHSDK SKPGQFIRSV DPDSPAEASG LRAQDRIVEV NGVCMEGKQH GDVVSAIRAG GDETKLLVVD RETDEFFKKC RVIPSQEHLN GPLPVPFTNG EIQKENSR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.8 % (1343 of 1463) | 93.1 % (719 of 772) | 89.0 % (501 of 563) | 96.1 % (123 of 128) |
Backbone | 95.1 % (711 of 748) | 95.4 % (247 of 259) | 94.6 % (351 of 371) | 95.8 % (113 of 118) |
Sidechain | 90.0 % (747 of 830) | 92.0 % (472 of 513) | 86.3 % (265 of 307) | 100.0 % (10 of 10) |
Aromatic | 68.8 % (55 of 80) | 87.5 % (35 of 40) | 50.0 % (20 of 40) | |
Methyl | 97.4 % (113 of 116) | 98.3 % (57 of 58) | 96.6 % (56 of 58) |
1. PDZ2-270
GIDPFTMLRP RLCTMKKGPS GYGFNLHSDK SKPGQFIRSV DPDSPAEASG LRAQDRIVEV NGVCMEGKQH GDVVSAIRAG GDETKLLVVD RETDEFFKKC RVIPSQEHLN GPLPVPFTNG EIQKENSRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PDZ2-270 | [U-100% 13C; U-100% 15N] | 550 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | PMSF | natural abundance | 0.1 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | direct | 1.0 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PDZ2-270 | [U-100% 13C; U-100% 15N] | 550 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | PMSF | natural abundance | 0.1 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PDZ2-270 | [U-100% 13C; U-100% 15N] | 550 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | PMSF | natural abundance | 0.1 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PDZ2-270 | [U-100% 13C; U-100% 15N] | 550 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | PMSF | natural abundance | 0.1 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PDZ2-270 | [U-100% 13C; U-100% 15N] | 550 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | PMSF | natural abundance | 0.1 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PDZ2-270 | [U-100% 13C; U-100% 15N] | 550 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | PMSF | natural abundance | 0.1 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PDZ2-270 | [U-100% 13C; U-100% 15N] | 550 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | PMSF | natural abundance | 0.1 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PDZ2-270 | [U-100% 13C; U-100% 15N] | 550 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | PMSF | natural abundance | 0.1 mM | |
5 | sodium chloride | natural abundance | 150 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16637_2kjd.nef |
Input source #2: Coordindates | 2kjd.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC -------110-------120-------- RVIPSQEHLNGPLPVPFTNGEIQKENSR |||||||||||||||||||||||||||| RVIPSQEHLNGPLPVPFTNGEIQKENSR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 128 | 0 | 0 | 100.0 |
Content subtype: combined_16637_2kjd.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .IDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC -------110-------120-------- RVIPSQEHLNGPLPVPFTNGEIQKENSR |||||||||||||||||||||||||||| RVIPSQEHLNGPLPVPFTNGEIQKENSR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
9 | ARG | HH11 | 6.342 |
9 | ARG | HH12 | 6.342 |
11 | ARG | HH11 | 6.708 |
11 | ARG | HH12 | 6.708 |
44 | SER | HG | 6.634 |
49 | SER | HG | 5.023 |
56 | ARG | HH11 | 7.291 |
56 | ARG | HH12 | 7.291 |
84 | THR | HG1 | 4.109 |
93 | THR | HG1 | 6.101 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 772 | 717 | 92.9 |
13C chemical shifts | 563 | 495 | 87.9 |
15N chemical shifts | 137 | 123 | 89.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 259 | 248 | 95.8 |
13C chemical shifts | 256 | 234 | 91.4 |
15N chemical shifts | 118 | 112 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 513 | 469 | 91.4 |
13C chemical shifts | 307 | 261 | 85.0 |
15N chemical shifts | 19 | 11 | 57.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 59 | 96.7 |
13C chemical shifts | 61 | 58 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 35 | 87.5 |
13C chemical shifts | 40 | 18 | 45.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC |||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .IDPFTMLRPRLCTMKKGPSGYGFNLHSD.SKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------- RVIPSQEHLNGPLPVPFTNGEIQKENSR ||||||||||||||||| ||||||| RVIPSQEHLNGPLPVPF.NGEIQKE -------110-------120-----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC ||| |||||||||| ||||||||| |||||||| ||||| ||||||||| |||||||||||| ||||||||||||||||||| .IDP...LRPRLCTMKK....YGFNLHSDK...GQFIRSVD...PAEAS.......IVEVNGVCM...QHGDVVSAIRAG.DETKLLVVDRETDEFFKKC --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------- RVIPSQEHLNGPLPVPFTNGEIQKENSR ||||| ....SQEHL ---------