Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Content subtype: bmr16669_3.str

Assigned chemical shifts

1. Saveframe: assignments_RhoA
   • Status: Warning
   • Sequence coverage of experimental data
     • Entity_assembly_ID: 1, Chain length: 181, Sequence coverage: 74.0%

     --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
     MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT
     |||||||||||  | ||        ||||                ||||||||              ||  ||||||||||  |||||||||||||||||
     MAAIRKKLVIV..G.CG........SKDQ................IEVDGKQV..............RL..LSYPDTDVIL..FSIDSPDSLENIPEKWT
     
     -------110-------120-------130-------140-------150-------160-------170-------180-
     PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
     |||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||
     PEVKHFCPNVPIILVG.KKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECS.KTKDGVREVFEMATRAALQA
     

   • Total number of assignments
     • ¹H chemical shifts: 118
     • ¹³C chemical shifts: 313
     • ¹⁵N chemical shifts: 117
   • Completeness of assignments
     • Entity_assemble_ID: 1
       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	1105	118	10.7
         13C chemical shifts	828	313	37.8
         15N chemical shifts	193	117	60.6

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	361	118	32.7
         13C chemical shifts	362	214	59.1
         15N chemical shifts	170	117	68.8

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	744	0	0.0
         13C chemical shifts	466	99	21.2
         15N chemical shifts	23	0	0.0

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	106	0	0.0
         13C chemical shifts	106	8	7.5

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	71	0	0.0
         13C chemical shifts	69	0	0.0
         15N chemical shifts	2	0	0.0

   • Redox state of CYS
     • 1:107:CYS, CA: 58.75 ppm, CB: 29.0 ppm
       • Redox_state (pred. by CS): reduced
     • 1:159:CYS, CA: 55.93 ppm, CB: 31.97 ppm
       • Redox_state (pred. by CS): reduced
   • Peptide bond of PRO
     • 1:89:PRO, CB: 31.9 ppm, CG: None ppm
       • Peptide_bond (pred. by CS): cis 11.1%, trans 88.9%
     • 1:96:PRO, CB: 31.05 ppm, CG: None ppm
       • Peptide_bond (pred. by CS): cis 2.8%, trans 97.2%
     • 1:101:PRO, CB: 31.05 ppm, CG: None ppm
       • Peptide_bond (pred. by CS): cis 2.8%, trans 97.2%
     • 1:108:PRO, CB: 31.61 ppm, CG: None ppm
       • Peptide_bond (pred. by CS): cis 6.9%, trans 93.1%
     • 1:111:PRO, CB: 32.39 ppm, CG: None ppm
       • Peptide_bond (pred. by CS): cis 24.4%, trans 75.6%
     • 1:138:PRO, CB: 32.32 ppm, CG: None ppm
       • Peptide_bond (pred. by CS): cis 21.9%, trans 78.1%
     • 1:141:PRO, CB: 31.61 ppm, CG: None ppm
       • Peptide_bond (pred. by CS): cis 6.9%, trans 93.1%
   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: 1