Solution Structure of the Ubiquitin-Binding Motif of Human Polymerase Iota
MQYKLILNGK TLKGETTTEA VDAATAEKVF KQYANDNGVD GEWTYDDATK TFTVTEGSDE KITFPSDIDP QVFYELPEAV QKELLAEWKR TGSDFHIGHK LEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.6 % (1138 of 1256) | 91.8 % (593 of 646) | 89.1 % (442 of 496) | 90.4 % (103 of 114) |
Backbone | 94.4 % (606 of 642) | 94.1 % (207 of 220) | 94.6 % (300 of 317) | 94.3 % (99 of 105) |
Sidechain | 87.6 % (626 of 715) | 90.6 % (386 of 426) | 84.3 % (236 of 280) | 44.4 % (4 of 9) |
Aromatic | 65.2 % (90 of 138) | 78.3 % (54 of 69) | 50.7 % (34 of 67) | 100.0 % (2 of 2) |
Methyl | 99.1 % (107 of 108) | 100.0 % (54 of 54) | 98.1 % (53 of 54) |
1. Ubiquitin-Binding Motif
MQYKLILNGK TLKGETTTEA VDAATAEKVF KQYANDNGVD GEWTYDDATK TFTVTEGSDE KITFPSDIDP QVFYELPEAV QKELLAEWKR TGSDFHIGHK LEHHHHHHSolvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBM2 | [U-100% 13C; U-100% 15N] | 1.0 ~ 4.0 mM | |
2 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBM2 | [U-100% 13C; U-100% 15N] | 1.0 ~ 4.0 mM | |
2 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBM2 | [U-100% 13C; U-100% 15N] | 1.0 ~ 4.0 mM | |
2 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBM2 | [U-100% 13C; U-100% 15N] | 1.0 ~ 4.0 mM | |
2 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBM2 | [U-100% 13C; U-100% 15N] | 1.0 ~ 4.0 mM | |
2 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBM2 | [U-100% 13C; U-100% 15N] | 1.0 ~ 4.0 mM | |
2 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBM2 | [U-100% 13C; U-100% 15N] | 1.0 ~ 4.0 mM | |
2 | D2O | natural abundance | 100 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBM2 | [U-100% 13C; U-100% 15N] | 1.0 ~ 4.0 mM | |
2 | D2O | natural abundance | 100 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBM2 | [U-100% 13C; U-100% 15N] | 1.0 ~ 4.0 mM | |
2 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16882_2khu.nef |
Input source #2: Coordindates | 2khu.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSDEKITFPSDIDPQVFYELPEAVQKELLAEWKRTGSDFHIGHK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSDEKITFPSDIDPQVFYELPEAVQKELLAEWKRTGSDFHIGHK -------- LEHHHHHH |||||||| LEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_16882_2khu.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSDEKITFPSDIDPQVFYELPEAVQKELLAEWKRTGSDFHIGHK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSDEKITFPSDIDPQVFYELPEAVQKELLAEWKRTGSDFHIGHK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- LEHHHHHH ||| LEH ---
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
96 | HIS | HD1 | 7.012 |
99 | HIS | HD1 | 6.97 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 646 | 584 | 90.4 |
13C chemical shifts | 496 | 435 | 87.7 |
15N chemical shifts | 115 | 103 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 220 | 209 | 95.0 |
13C chemical shifts | 216 | 206 | 95.4 |
15N chemical shifts | 105 | 99 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 426 | 375 | 88.0 |
13C chemical shifts | 280 | 229 | 81.8 |
15N chemical shifts | 10 | 4 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 54 | 98.2 |
13C chemical shifts | 55 | 53 | 96.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 52 | 75.4 |
13C chemical shifts | 67 | 31 | 46.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
Dihedral angle restraints
RDC restraints