NMR Structure of Escherichia coli BamE, a Lipoprotein Component of the beta-Barrel Assembly Machinery Complex
GSHMSTLERV VYRPDINQGN YLTANDVSKI RVGMTQQQVA YALGTPLMSD PFGTNTWFYV FRQQPGHEGV TQQTLTLTFN SSGVLTNIDN KPALSGN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 71.0 % (785 of 1106) | 77.2 % (440 of 570) | 58.5 % (250 of 427) | 87.2 % (95 of 109) |
Backbone | 71.0 % (406 of 572) | 88.9 % (176 of 198) | 51.8 % (146 of 282) | 91.3 % (84 of 92) |
Sidechain | 73.5 % (457 of 622) | 71.0 % (264 of 372) | 78.1 % (182 of 233) | 64.7 % (11 of 17) |
Aromatic | 41.3 % (38 of 92) | 41.3 % (19 of 46) | 40.0 % (18 of 45) | 100.0 % (1 of 1) |
Methyl | 89.6 % (95 of 106) | 86.8 % (46 of 53) | 92.5 % (49 of 53) |
1. E. coli lipoprotein
GSHMSTLERV VYRPDINQGN YLTANDVSKI RVGMTQQQVA YALGTPLMSD PFGTNTWFYV FRQQPGHEGV TQQTLTLTFN SSGVLTNIDN KPALSGNSolvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 298 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli protein | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 15 % | |
3 | H2O | natural abundance | 85 % | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian Unity - 500 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 298 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli protein | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 15 % | |
3 | H2O | natural abundance | 85 % | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM |
Varian Unity - 500 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 298 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli protein | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 15 % | |
3 | H2O | natural abundance | 85 % | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM |
Varian Unity - 500 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 298 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli protein | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 15 % | |
3 | H2O | natural abundance | 85 % | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM |
Varian Unity - 500 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 298 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli protein | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 15 % | |
3 | H2O | natural abundance | 85 % | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM |
Varian Unity - 500 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 298 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli protein | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 15 % | |
3 | H2O | natural abundance | 85 % | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM |
Varian Unity - 500 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 298 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli protein | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 15 % | |
3 | H2O | natural abundance | 85 % | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM |
Varian Unity - 500 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 298 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli protein | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 15 % | |
3 | H2O | natural abundance | 85 % | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM |
Varian Unity - 500 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 298 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli protein | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 15 % | |
3 | H2O | natural abundance | 85 % | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16926_2kxx.nef |
Input source #2: Coordindates | 2kxx.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--20--------30--------40--------50--------60--------70--------80--------90-------100-------110--- GSHMSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 97 | 0 | 0 | 100.0 |
Content subtype: combined_16926_2kxx.nef
Assigned chemical shifts
--20--------30--------40--------50--------60--------70--------80--------90-------100-------110--- GSHMSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........VVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 570 | 444 | 77.9 |
13C chemical shifts | 427 | 236 | 55.3 |
15N chemical shifts | 113 | 92 | 81.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 198 | 175 | 88.4 |
13C chemical shifts | 194 | 55 | 28.4 |
15N chemical shifts | 92 | 81 | 88.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 372 | 269 | 72.3 |
13C chemical shifts | 233 | 181 | 77.7 |
15N chemical shifts | 21 | 11 | 52.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 50 | 89.3 |
13C chemical shifts | 56 | 51 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 19 | 41.3 |
13C chemical shifts | 45 | 18 | 40.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
Dihedral angle restraints
--20--------30--------40--------50--------60--------70--------80--------90-------100-------110--- GSHMSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN ||| |||| |||||||||||||||||||||||||| |||||||||||| ||||||||||||||||||||| GSH.......VYRP......YLTANDVSKIRVGMTQQQVAYALGTP.....FGTNTWFYVFRQ........QQTLTLTFNSSGVLTNIDNKP --20--------30--------40--------50--------60--------70--------80--------90-------100--------