Fyn SH2 free form
NHKVHHHHHH MEWYFGKLGR KDAERQLLSF GNPRGTFLIR ESETTKGAYS LSIRDWDDMK GDHVKHYKIR KLDNGGYYIT TRAQFETLQQ LVQHYSERAA GLCCRLVVPC HK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.3 % (1249 of 1353) | 91.2 % (646 of 708) | 92.8 % (487 of 525) | 96.7 % (116 of 120) |
Backbone | 96.3 % (643 of 668) | 96.1 % (222 of 231) | 96.3 % (315 of 327) | 96.4 % (106 of 110) |
Sidechain | 89.6 % (706 of 788) | 88.9 % (424 of 477) | 90.4 % (272 of 301) | 100.0 % (10 of 10) |
Aromatic | 73.7 % (115 of 156) | 74.4 % (58 of 78) | 72.4 % (55 of 76) | 100.0 % (2 of 2) |
Methyl | 100.0 % (98 of 98) | 100.0 % (49 of 49) | 100.0 % (49 of 49) |
1. FynSH2free correct
NHKVHHHHHH MEWYFGKLGR KDAERQLLSF GNPRGTFLIR ESETTKGAYS LSIRDWDDMK GDHVKHYKIR KLDNGGYYIT TRAQFETLQQ LVQHYSERAA GLCCRLVVPC HKSolvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Varian Varian NMR Systems - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 298.150 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2free_correct | [U-98% 13C; U-98% 15N] | 0.8 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17368_2mqi.nef |
Input source #2: Coordindates | 2mqi.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--140-----150-------160-------170-------180-------190-------200-------210-------220-------230------- NKVHHHHHHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NKVHHHHHHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 240-------- LCCRLVVPCHK ||||||||||| LCCRLVVPCHK -------110-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 111 | 0 | 0 | 100.0 |
Content subtype: combined_17368_2mqi.nef
Assigned chemical shifts
--140-----150-------160-------170-------180-------190-------200-------210-------220-------230------- NKVHHHHHHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAG ||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NKVHH...HMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAG 240-------- LCCRLVVPCHK ||||||||||| LCCRLVVPCHK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 702 | 639 | 91.0 |
15N chemical shifts | 128 | 113 | 88.3 |
13C chemical shifts | 520 | 480 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 229 | 218 | 95.2 |
15N chemical shifts | 109 | 103 | 94.5 |
13C chemical shifts | 222 | 210 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 473 | 421 | 89.0 |
15N chemical shifts | 19 | 10 | 52.6 |
13C chemical shifts | 298 | 270 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 50 | 98.0 |
13C chemical shifts | 51 | 50 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 58 | 76.3 |
15N chemical shifts | 2 | 2 | 100.0 |
13C chemical shifts | 74 | 55 | 74.3 |
Distance restraints
--140-----150-------160-------170-------180-------190-------200-------210-------220-------230------- NKVHHHHHHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAG 240-------- LCCRLVVPCHK ||||||||||| LCCRLVVPCHK
--140-----150-------160-------170-------180-------190-------200-------210-------220-------230------- NKVHHHHHHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAG ||||||||||||||||| ||||||||||||||||||||||||| |||||||||||||||||| |||| |||||||||||||||||||| ...........WYFGKLGRKDAERQLLS..NPRGTFLIRESETTKGAYSLSIRDW.DMKGDHVKHYKIRKLDNG.YYIT.RAQFETLQQLVQHYSERAAG 240-------- LCCRLVVPCHK ||||||||||| LCCRLVVPCHK