1H, 13C, and 15N resonance assignments and secondary structure prediction of the full-length transition state regulator AbrB from Bacillus anthracis
MKSTGIVRKV DELGRVVIPI ELRRTLGIAE KDALEIYVDD EKIILKKYKP NMTCQVTGEV SDGNLFLAEG KIILSKEGAE QILNELQDYI ETAK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.8 % (1046 of 1115) | 94.5 % (551 of 583) | 93.1 % (404 of 434) | 92.9 % (91 of 98) |
Backbone | 97.9 % (548 of 560) | 98.4 % (190 of 193) | 97.1 % (267 of 275) | 98.9 % (91 of 92) |
Sidechain | 91.0 % (584 of 642) | 92.6 % (361 of 390) | 90.7 % (223 of 246) | 0.0 % (0 of 6) |
Aromatic | 76.5 % (26 of 34) | 100.0 % (17 of 17) | 52.9 % (9 of 17) | |
Methyl | 96.2 % (127 of 132) | 100.0 % (66 of 66) | 92.4 % (61 of 66) |
1. ba
MKSTGIVRKV DELGRVVIPI ELRRTLGIAE KDALEIYVDD EKIILKKYKP NMTCQVTGEV SDGNLFLAEG KIILSKEGAE QILNELQDYI ETAKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ba | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | potassium phosphate | natural abundance | 10 mM | |
4 | potassium chloride | natural abundance | 15 mM | |
5 | sodium azide | natural abundance | .02 % | |
6 | EDTA | natural abundance | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr17650_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDGNLFLAEGKIILSKEGAEQILNELQDYIETAK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDGNLFLAEGKIILSKEGAEQILNELQDYIETAK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 583 | 549 | 94.2 |
13C chemical shifts | 434 | 399 | 91.9 |
15N chemical shifts | 102 | 91 | 89.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 193 | 192 | 99.5 |
13C chemical shifts | 188 | 180 | 95.7 |
15N chemical shifts | 92 | 91 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 390 | 357 | 91.5 |
13C chemical shifts | 246 | 219 | 89.0 |
15N chemical shifts | 10 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 66 | 97.1 |
13C chemical shifts | 68 | 60 | 88.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 17 | 100.0 |
13C chemical shifts | 17 | 9 | 52.9 |