na1
MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSMSYGRP PPDVEGMTSL KVDNLTYRTS PDTLRRVFEK YGRVGDVYIP RDRYTKESRG FAFVRFHDKR DAEDAMDAMD GAVLDGRELR VQMARYGRPP DSHHS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 62.3 % (939 of 1507) | 70.9 % (561 of 791) | 48.0 % (281 of 585) | 74.0 % (97 of 131) |
Backbone | 58.3 % (463 of 794) | 70.8 % (196 of 277) | 44.1 % (172 of 390) | 74.8 % (95 of 127) |
Sidechain | 67.0 % (558 of 833) | 71.0 % (365 of 514) | 60.6 % (191 of 315) | 50.0 % (2 of 4) |
Aromatic | 57.8 % (74 of 128) | 76.6 % (49 of 64) | 39.1 % (25 of 64) | |
Methyl | 86.7 % (78 of 90) | 86.7 % (39 of 45) | 86.7 % (39 of 45) |
1. SRSF2 RRM
MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSMSYGRP PPDVEGMTSL KVDNLTYRTS PDTLRRVFEK YGRVGDVYIP RDRYTKESRG FAFVRFHDKR DAEDAMDAMD GAVLDGRELR VQMARYGRPP DSHHSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
9 | L-Arg | natural abundance | 50 mM | |
10 | L-Glu | natural abundance | 50 mM | |
11 | NaH2PO4 | natural abundance | 20 mM | |
12 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
9 | L-Arg | natural abundance | 50 mM | |
10 | L-Glu | natural abundance | 50 mM | |
11 | NaH2PO4 | natural abundance | 20 mM | |
12 | D2O | natural abundance | 100 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM 2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SRSF2 RRM 1 | [U-15N] | 0.75 (±0.1) mM | |
9 | L-Arg | natural abundance | 50 mM | |
10 | L-Glu | natural abundance | 50 mM | |
11 | NaH2PO4 | natural abundance | 20 mM | |
12 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17705_2lea.nef |
Input source #2: Coordindates | 2lea.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------------------------------------10--------20--------30--------40--------50--------60------ MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --70--------80--------90-------100- DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS ||||||||||||||||||||||||||||||||||| DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS -------110-------120-------130-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 135 | 0 | 0 | 100.0 |
Content subtype: combined_17705_2lea.nef
Assigned chemical shifts
------------------------------------------10--------20--------30--------40--------50--------60------ MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR ||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...................................SYGRP.PDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR --70--------80--------90-------100- DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS ||||||||||||||||||||||||||||| ||||| DAEDAMDAMDGAVLDGRELRVQMARYGRP.DSHHS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 791 | 556 | 70.3 |
13C chemical shifts | 585 | 264 | 45.1 |
15N chemical shifts | 147 | 96 | 65.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 277 | 193 | 69.7 |
13C chemical shifts | 270 | 76 | 28.1 |
15N chemical shifts | 127 | 91 | 71.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 514 | 363 | 70.6 |
13C chemical shifts | 315 | 188 | 59.7 |
15N chemical shifts | 20 | 5 | 25.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 43 | 79.6 |
13C chemical shifts | 54 | 43 | 79.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 49 | 76.6 |
13C chemical shifts | 64 | 25 | 39.1 |
Distance restraints
------------------------------------------10--------20--------30--------40--------50--------60------ MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR ||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...................................SYGRP.PDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR --70--------80--------90-------100- DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS ||||||||||||||||||||||||||||| ||||| DAEDAMDAMDGAVLDGRELRVQMARYGRP.DSHHS
Dihedral angle restraints