na2
MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSMSYGRP PPDVEGMTSL KVDNLTYRTS PDTLRRVFEK YGRVGDVYIP RDRYTKESRG FAFVRFHDKR DAEDAMDAMD GAVLDGRELR VQMARYGRPP DSHHS
Polymer type: polypeptide(L) polyribonucleotide
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 59.9 % (961 of 1605) | 70.7 % (597 of 845) | 43.5 % (272 of 626) | 68.7 % (92 of 134) |
Backbone | 54.3 % (467 of 860) | 68.4 % (214 of 313) | 38.8 % (163 of 420) | 70.9 % (90 of 127) |
Sidechain | 66.0 % (571 of 865) | 72.0 % (383 of 532) | 57.1 % (186 of 326) | 28.6 % (2 of 7) |
Aromatic | 56.4 % (88 of 156) | 76.9 % (60 of 78) | 37.3 % (28 of 75) | 0.0 % (0 of 3) |
Methyl | 81.1 % (73 of 90) | 80.0 % (36 of 45) | 82.2 % (37 of 45) |
1. SRSF2 RRM
MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSMSYGRP PPDVEGMTSL KVDNLTYRTS PDTLRRVFEK YGRVGDVYIP RDRYTKESRG FAFVRFHDKR DAEDAMDAMD GAVLDGRELR VQMARYGRPP DSHHS2. RNA
UCCAGUSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
9 | L-Arg | natural abundance | 50 mM | |
10 | L-Glu | natural abundance | 50 mM | |
11 | NaH2PO4 | natural abundance | 20 mM | |
12 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
2 | SRSF2 RRM + UCCAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
3 | L-Arg | natural abundance | 50 mM | |
4 | L-Glu | natural abundance | 50 mM | |
5 | NaH2PO4 | natural abundance | 20 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
9 | L-Arg | natural abundance | 50 mM | |
10 | L-Glu | natural abundance | 50 mM | |
11 | NaH2PO4 | natural abundance | 20 mM | |
12 | D2O | natural abundance | 100 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SRSF2 RRM + UCCAGU1 | [U-15N] | 0.75 (±0.1) mM | |
9 | L-Arg | natural abundance | 50 mM | |
10 | L-Glu | natural abundance | 50 mM | |
11 | NaH2PO4 | natural abundance | 20 mM | |
12 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17706_2leb.nef |
Input source #2: Coordindates | 2leb.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------------------------------------10--------20--------30--------40--------50--------60------ MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --70--------80--------90-------100- DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS ||||||||||||||||||||||||||||||||||| DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS -------110-------120-------130-----
------ UCCAGU |||||| UCCAGU
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 135 | 0 | 0 | 100.0 |
B | B | 6 | 0 | 0 | 100.0 |
Content subtype: combined_17706_2leb.nef
Assigned chemical shifts
------------------------------------------10--------20--------30--------40--------50--------60------ MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR ||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...................................SYGRP.PDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR --70--------80--------90-------100- DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS ||||||||||||||||||||||||||||||||||| DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
------ UCCAGU |||||| UCCAGU
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 791 | 560 | 70.8 |
13C chemical shifts | 585 | 246 | 42.1 |
15N chemical shifts | 147 | 100 | 68.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 277 | 192 | 69.3 |
13C chemical shifts | 270 | 67 | 24.8 |
15N chemical shifts | 127 | 90 | 70.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 514 | 368 | 71.6 |
13C chemical shifts | 315 | 179 | 56.8 |
15N chemical shifts | 20 | 10 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 42 | 77.8 |
13C chemical shifts | 54 | 41 | 75.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 49 | 76.6 |
13C chemical shifts | 64 | 27 | 42.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 34 | 63.0 |
13C chemical shifts | 41 | 0 | 0.0 |
15N chemical shifts | 3 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 23 | 63.9 |
13C chemical shifts | 30 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 18 | 11 | 61.1 |
13C chemical shifts | 11 | 0 | 0.0 |
15N chemical shifts | 3 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 3 | 3 | 100.0 |
13C chemical shifts | 3 | 0 | 0.0 |
Distance restraints
------------------------------------------10--------20--------30--------40--------50--------60------ MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR ||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...................................SYGRP.PDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR --70--------80--------90-------100- DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS ||||||||||||||||||||||||||||||||||| DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
------ UCCAGU |||||| UCCAGU
Dihedral angle restraints