na3
MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSMSYGRP PPDVEGMTSL KVDNLTYRTS PDTLRRVFEK YGRVGDVYIP RDRYTKESRG FAFVRFHDKR DAEDAMDAMD GAVLDGRELR VQMARYGRPP DSHHS
Polymer type: polypeptide(L) polyribonucleotide
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 62.4 % (999 of 1601) | 72.1 % (606 of 841) | 48.1 % (300 of 624) | 68.4 % (93 of 136) |
Backbone | 58.0 % (499 of 860) | 71.9 % (225 of 313) | 43.8 % (184 of 420) | 70.9 % (90 of 127) |
Sidechain | 66.8 % (575 of 861) | 71.8 % (379 of 528) | 59.9 % (194 of 324) | 22.2 % (2 of 9) |
Aromatic | 56.4 % (88 of 156) | 74.4 % (58 of 78) | 41.1 % (30 of 73) | 0.0 % (0 of 5) |
Methyl | 88.9 % (80 of 90) | 88.9 % (40 of 45) | 88.9 % (40 of 45) |
1. SRSF2 RRM
MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSMSYGRP PPDVEGMTSL KVDNLTYRTS PDTLRRVFEK YGRVGDVYIP RDRYTKESRG FAFVRFHDKR DAEDAMDAMD GAVLDGRELR VQMARYGRPP DSHHS2. RNA (5'-R(*UP*GP*GP*AP*GP*U)-3')
UGGAGUSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
11 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
12 | L-Arg | natural abundance | 50 mM | |
13 | L-Glu | natural abundance | 50 mM | |
14 | NaH2PO4 | natural abundance | 20 mM | |
15 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
2 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
3 | SRSF2 RRM | [U-13C; U-15N] | 0.75 (±0.1) mM | |
4 | UGGAGU2 | [U-13C; U-15N] | 0.75 (±0.1) mM | |
5 | L-Arg | natural abundance | 50 mM | |
6 | L-Glu | natural abundance | 50 mM | |
7 | NaH2PO4 | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
11 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
12 | L-Arg | natural abundance | 50 mM | |
13 | L-Glu | natural abundance | 50 mM | |
14 | NaH2PO4 | natural abundance | 20 mM | |
15 | D2O | natural abundance | 100 % |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310.8 K, pH 5.5, Details 50mM L-Arg; 50mM L-Glu; 20mM NaH2PO4; ph 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | SRSF2 RRM | [U-15N] | 0.75 (±0.1) mM | |
11 | UGGAGU1 | [U-15N] | 0.75 (±0.1) mM | |
12 | L-Arg | natural abundance | 50 mM | |
13 | L-Glu | natural abundance | 50 mM | |
14 | NaH2PO4 | natural abundance | 20 mM | |
15 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17707_2lec.nef |
Input source #2: Coordindates | 2lec.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------------------------------------10--------20--------30--------40--------50--------60------ MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --70--------80--------90-------100- DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS ||||||||||||||||||||||||||||||||||| DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS -------110-------120-------130-----
------ UGGAGU |||||| UGGAGU
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 135 | 0 | 0 | 100.0 |
B | B | 6 | 0 | 0 | 100.0 |
Content subtype: combined_17707_2lec.nef
Assigned chemical shifts
------------------------------------------10--------20--------30--------40--------50--------60------ MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...................................SYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR --70--------80--------90-------100- DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS ||||||||||||||||||||||||||||||||||| DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
------ UGGAGU |||||| UGGAGU
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 791 | 546 | 69.0 |
13C chemical shifts | 585 | 268 | 45.8 |
15N chemical shifts | 147 | 97 | 66.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 277 | 191 | 69.0 |
13C chemical shifts | 270 | 88 | 32.6 |
15N chemical shifts | 127 | 88 | 69.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 514 | 355 | 69.1 |
13C chemical shifts | 315 | 180 | 57.1 |
15N chemical shifts | 20 | 9 | 45.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 43 | 79.6 |
13C chemical shifts | 54 | 43 | 79.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 47 | 73.4 |
13C chemical shifts | 64 | 28 | 43.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 37 | 74.0 |
13C chemical shifts | 39 | 0 | 0.0 |
15N chemical shifts | 5 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 28 | 77.8 |
13C chemical shifts | 30 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 9 | 64.3 |
13C chemical shifts | 9 | 0 | 0.0 |
15N chemical shifts | 5 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 5 | 5 | 100.0 |
13C chemical shifts | 5 | 0 | 0.0 |
Distance restraints
------------------------------------------10--------20--------30--------40--------50--------60------ MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR ||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||| ...................................SYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIP.DRYTKESRGFAFVRFHDKR --70--------80--------90-------100- DAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS |||||||||||||||||||||||| | |||||||| DAEDAMDAMDGAVLDGRELRVQMA.Y.RPPDSHHS
------ UGGAGU |||||| UGGAGU
Dihedral angle restraints