SOLUTION STRUCTURE OF THE HUMAN PROLACTIN RECEPTOR ECD DOMAIN D2
MYIVQPDPPL ELAVEVKQPE DRKPYLWIKW SPPTLIDLKT GWFTLLYEIR LKPEKAAEWE IHFAGQQTEF KILSLHPGQK YLVQVRCKPD HGYWSAWSPA TFIQIPSDFT MND
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.8 % (1340 of 1428) | 91.3 % (683 of 748) | 96.6 % (546 of 565) | 96.5 % (111 of 115) |
Backbone | 97.2 % (636 of 654) | 97.2 % (212 of 218) | 97.3 % (326 of 335) | 97.0 % (98 of 101) |
Sidechain | 92.0 % (812 of 883) | 88.9 % (471 of 530) | 96.8 % (328 of 339) | 92.9 % (13 of 14) |
Aromatic | 94.3 % (164 of 174) | 96.6 % (84 of 87) | 91.4 % (74 of 81) | 100.0 % (6 of 6) |
Methyl | 100.0 % (120 of 120) | 100.0 % (60 of 60) | 100.0 % (60 of 60) |
1. hPRLR-D2
MYIVQPDPPL ELAVEVKQPE DRKPYLWIKW SPPTLIDLKT GWFTLLYEIR LKPEKAAEWE IHFAGQQTEF KILSLHPGQK YLVQVRCKPD HGYWSAWSPA TFIQIPSDFT MNDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | hPRLR-D2 | [U-100% 13C(1)] | 0.5 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | TCEP | natural abundance | 10 mM | |
11 | sodium azide | natural abundance | 0.02 % | |
12 | DSS | natural abundance | 1 mM | |
13 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPRLR-D2 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | TCEP | natural abundance | 10 mM | |
4 | DSS | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | hPRLR-D2 | [U-100% 13C(1)] | 0.5 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | TCEP | natural abundance | 10 mM | |
11 | sodium azide | natural abundance | 0.02 % | |
12 | DSS | natural abundance | 1 mM | |
13 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17752_2lfg.nef |
Input source #2: Coordindates | 2lfg.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- MYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 200-------210 TFIQIPSDFTMND ||||||||||||| TFIQIPSDFTMND -------110---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 113 | 0 | 0 | 100.0 |
Content subtype: combined_17752_2lfg.nef
Assigned chemical shifts
--100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- MYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPA 200-------210 TFIQIPSDFTMND ||||||||||||| TFIQIPSDFTMND
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
115 | GLN | CD | 180.272 |
144 | TYR | HH | 9.461 |
147 | ARG | HH21 | 6.902 |
147 | ARG | HH22 | 7.822 |
147 | ARG | NH2 | 113.396 |
163 | GLN | CD | 180.68 |
164 | GLN | CD | 180.879 |
181 | GLN | CD | 180.189 |
209 | ASN | CG | 177.178 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 748 | 686 | 91.7 |
13C chemical shifts | 565 | 544 | 96.3 |
15N chemical shifts | 118 | 111 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 218 | 214 | 98.2 |
13C chemical shifts | 226 | 219 | 96.9 |
15N chemical shifts | 101 | 98 | 97.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 530 | 472 | 89.1 |
13C chemical shifts | 339 | 325 | 95.9 |
15N chemical shifts | 17 | 13 | 76.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 60 | 96.8 |
13C chemical shifts | 62 | 60 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 87 | 84 | 96.6 |
13C chemical shifts | 81 | 74 | 91.4 |
15N chemical shifts | 6 | 6 | 100.0 |
Distance restraints
--100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- MYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .YIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPA 200-------210 TFIQIPSDFTMND ||||||||||||| TFIQIPSDFTMND
Dihedral angle restraints
--100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- MYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPA |||| ||||||||| ||||||||| ||||||||||||||||||||| ||||||||||||||||||||||||| || ..IVQP...LELAVEVKQ.....PYLWIKWSP...........TLLYEIRLKPEKAAEWEIHFA...TEFKILSLHPGQKYLVQVRCKPDHG......PA --100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- 200-------210 TFIQIPSDFTMND |||||| TFIQIP 200---