Solution NMR structure of Alr2454 protein from Nostoc sp. strain PCC 7120, Northeast Structural Genomics Consortium Target NsR264
MTGQELRQLL LDKWGYSYDV QFRRTQGKIF LQVMWKYLEQ ASFPMNETEY QEHLDSVANY LHALGGAVQV KTFITQTKER PRLGKAVSIP LDLGERASEW IILEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.6 % (1277 of 1350) | 94.7 % (666 of 703) | 94.5 % (497 of 526) | 94.2 % (114 of 121) |
Backbone | 94.0 % (615 of 654) | 92.9 % (208 of 224) | 95.0 % (307 of 323) | 93.5 % (100 of 107) |
Sidechain | 95.1 % (760 of 799) | 95.6 % (458 of 479) | 94.1 % (288 of 306) | 100.0 % (14 of 14) |
Aromatic | 83.8 % (124 of 148) | 85.1 % (63 of 74) | 81.7 % (58 of 71) | 100.0 % (3 of 3) |
Methyl | 100.0 % (120 of 120) | 100.0 % (60 of 60) | 100.0 % (60 of 60) |
1. NsR264
MTGQELRQLL LDKWGYSYDV QFRRTQGKIF LQVMWKYLEQ ASFPMNETEY QEHLDSVANY LHALGGAVQV KTFITQTKER PRLGKAVSIP LDLGERASEW IILEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 0.567 mM [U-5% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NsR264 | [U-5% 13C; U-100% 15N] | 0.567 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 0.567 mM [U-5% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NsR264 | [U-5% 13C; U-100% 15N] | 0.567 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm TCI microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.01 mM [U-100% 13C; U-100% 15N] NsR264, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR264 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17965_2ljw.nef |
Input source #2: Coordindates | 2ljw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTGQELRQLLLDKWGYSYDVQFRRTQGKIFLQVMWKYLEQASFPMNETEYQEHLDSVANYLHALGGAVQVKTFITQTKERPRLGKAVSIPLDLGERASEW |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTGQELRQLLLDKWGYSYDVQFRRTQGKIFLQVMWKYLEQASFPMNETEYQEHLDSVANYLHALGGAVQVKTFITQTKERPRLGKAVSIPLDLGERASEW -------110 IILEHHHHHH |||||||||| IILEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 110 | 0 | 0 | 100.0 |
Content subtype: combined_17965_2ljw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTGQELRQLLLDKWGYSYDVQFRRTQGKIFLQVMWKYLEQASFPMNETEYQEHLDSVANYLHALGGAVQVKTFITQTKERPRLGKAVSIPLDLGERASEW |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTGQELRQLLLDKWGYSYDVQFRRTQGKIFLQVMWKYLEQASFPMNETEYQEHLDSVANYLHALGGAVQVKTFITQTKERPRLGKAVSIPLDLGERASEW --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 IILEHHHHHH |||| IILE ----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
4 | GLN | CD | 180.075 |
8 | GLN | CD | 180.382 |
21 | GLN | CD | 180.046 |
26 | GLN | CD | 181.058 |
32 | GLN | CD | 179.505 |
46 | ASN | CG | 175.892 |
51 | GLN | CD | 179.8 |
59 | ASN | CG | 176.111 |
69 | GLN | CD | 180.041 |
76 | GLN | CD | 180.274 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 703 | 664 | 94.5 |
13C chemical shifts | 526 | 490 | 93.2 |
15N chemical shifts | 127 | 119 | 93.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 224 | 210 | 93.8 |
13C chemical shifts | 220 | 207 | 94.1 |
15N chemical shifts | 107 | 99 | 92.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 479 | 454 | 94.8 |
13C chemical shifts | 306 | 283 | 92.5 |
15N chemical shifts | 20 | 20 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 63 | 100.0 |
13C chemical shifts | 63 | 63 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 61 | 82.4 |
13C chemical shifts | 71 | 54 | 76.1 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTGQELRQLLLDKWGYSYDVQFRRTQGKIFLQVMWKYLEQASFPMNETEYQEHLDSVANYLHALGGAVQVKTFITQTKERPRLGKAVSIPLDLGERASEW |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTGQELRQLLLDKWGYSYDVQFRRTQGKIFLQVMWKYLEQASFPMNETEYQEHLDSVANYLHALGGAVQVKTFITQTKERPRLGKAVSIPLDLGERASEW --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 IILEHHHHHH |||| IILE ----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTGQELRQLLLDKWGYSYDVQFRRTQGKIFLQVMWKYLEQASFPMNETEYQEHLDSVANYLHALGGAVQVKTFITQTKERPRLGKAVSIPLDLGERASEW ||||||||||||||| |||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTGQELRQLLLDKWG...DVQFRRTQGKIFLQVM.KYLEQASFPMNETEYQEHLDSVANYLHALGGAVQVKTFITQTKERPRLGKAVSIPLDLGERASEW --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 IILEHHHHHH | I -