Solution NMR Structure of DE NOVO DESIGNED PROTEIN, PFK fold, Northeast Structural Genomics Consortium Target OR134
MGKVLLVIST DTNIISSVQE RAKHNYPGRY IRTATSSQDI RDIIKSMKDN GKPLVVFVNG ASQNDVNEFQ NEAKKEGVSY DVLKSTDPEE LTQRVREFLK TAGSLEHHHH HH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.2 % (1188 of 1302) | 91.5 % (621 of 679) | 91.4 % (459 of 502) | 89.3 % (108 of 121) |
Backbone | 90.7 % (604 of 666) | 90.7 % (206 of 227) | 91.5 % (302 of 330) | 88.1 % (96 of 109) |
Sidechain | 92.2 % (684 of 742) | 91.8 % (415 of 452) | 92.4 % (257 of 278) | 100.0 % (12 of 12) |
Aromatic | 68.3 % (56 of 82) | 68.3 % (28 of 41) | 68.3 % (28 of 41) | |
Methyl | 99.2 % (119 of 120) | 98.3 % (59 of 60) | 100.0 % (60 of 60) |
1. OR134
MGKVLLVIST DTNIISSVQE RAKHNYPGRY IRTATSSQDI RDIIKSMKDN GKPLVVFVNG ASQNDVNEFQ NEAKKEGVSY DVLKSTDPEE LTQRVREFLK TAGSLEHHHH HHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.3 mM [U-100% 13C; U-100% 15N] OR134, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR134 | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.15 mM [U-5% 13C; U-100% 15N] OR134, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR134 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.15 mM [U-5% 13C; U-100% 15N] OR134, 95% H2O/5% D2O, peg or phage
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | OR134 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 6.5
Experiment name 2D 1H-15N HSQC
List #1 RDC_list_1, RDC code DNH, Field strength (1H) 599.520 MHz, Details Alignment media: Peg or Phage, Magnitude -6.349, Rhombicity 0.295, ORI residue number 120
List #2 RDC_list_2, RDC code DNH, Field strength (1H) 599.520 MHz, Details Alignment media: Peg or Phage, Magnitude -14.027, Rhombicity 0.481, ORI residue number 127
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.3 mM [U-100% 13C; U-100% 15N] OR134, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR134 | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.3 mM [U-100% 13C; U-100% 15N] OR134, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR134 | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.3 mM [U-100% 13C; U-100% 15N] OR134, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR134 | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.3 mM [U-100% 13C; U-100% 15N] OR134, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR134 | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.3 mM [U-100% 13C; U-100% 15N] OR134, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR134 | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.3 mM [U-100% 13C; U-100% 15N] OR134, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR134 | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.3 mM [U-100% 13C; U-100% 15N] OR134, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR134 | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz Rutgers
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.15 mM [U-5% 13C; U-100% 15N] OR134, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR134 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz UGA
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.15 mM [U-5% 13C; U-100% 15N] OR134, 95% H2O/5% D2O, peg or phage
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | OR134 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18161_2lnd.nef |
Input source #2: Coordindates | 2lnd.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGKVLLVISTDTNIISSVQERAKHNYPGRYIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGKVLLVISTDTNIISSVQERAKHNYPGRYIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLK -------110-- TAGSLEHHHHHH |||||||||||| TAGSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 112 | 0 | 0 | 100.0 |
Content subtype: combined_18161_2lnd.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGKVLLVISTDTNIISSVQERAKHNYPGRYIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GKVLLVISTDTNIISSVQERAKHNYPGRYIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-- TAGSLEHHHHHH ||||||| TAGSLEH -------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 679 | 626 | 92.2 |
13C chemical shifts | 502 | 458 | 91.2 |
15N chemical shifts | 127 | 108 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 227 | 207 | 91.2 |
13C chemical shifts | 224 | 201 | 89.7 |
15N chemical shifts | 109 | 95 | 87.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 452 | 419 | 92.7 |
13C chemical shifts | 278 | 257 | 92.4 |
15N chemical shifts | 18 | 13 | 72.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 61 | 98.4 |
13C chemical shifts | 62 | 61 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 28 | 68.3 |
13C chemical shifts | 41 | 28 | 68.3 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGKVLLVISTDTNIISSVQERAKHNYPGRYIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GKVLLVISTDTNIISSVQERAKHNYPGRYIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-- TAGSLEHHHHHH ||||||| TAGSLEH -------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGKVLLVISTDTNIISSVQERAKHNYPGRYIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLK ||||||||||||||||||||||||| ||||||||||||||||||||| |||||||| ||||||||||||||||||||||||||||||||||||||| .GKVLLVISTDTNIISSVQERAKHNY...YIRTATSSQDIRDIIKSMKDN..PLVVFVNG.SQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-- TAGSLEHHHHHH ||| TAG ---