Enterohaemorrhagic E. coli (EHEC) exploits a tryptophan switch to hijack host F-actin assembly
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.9 % (1768 of 2108) | 90.5 % (999 of 1104) | 74.5 % (608 of 816) | 85.6 % (161 of 188) |
Backbone | 79.5 % (835 of 1050) | 92.2 % (332 of 360) | 67.2 % (353 of 525) | 90.9 % (150 of 165) |
Sidechain | 89.5 % (1094 of 1223) | 89.7 % (667 of 744) | 91.2 % (416 of 456) | 47.8 % (11 of 23) |
Aromatic | 86.2 % (150 of 174) | 96.6 % (84 of 87) | 74.7 % (62 of 83) | 100.0 % (4 of 4) |
Methyl | 98.8 % (170 of 172) | 98.8 % (85 of 86) | 98.8 % (85 of 86) |
1. entity 1
GSNFQHIGHV GWDPNTGFDL NNLDPELKNL FDMCGISEAQ LKDRETSKVI YDFIEKTGGV EAVKN2. entity 2
GSHMKKQKVK TIFPHTAGSN KTLLSFAQGD VITLLIPEEK DGWLYGEHDV SKARGWFPSS YTKLLEE3. entity 3
GLPDVAQRLM QHLAEHGIQP ARNMAEHIPP APNWPAPTPP VQNEQSRPSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.783 ppm | internal | indirect | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.783 ppm | internal | indirect | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.783 ppm | internal | indirect | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-98% 13C; U-98% 15N] | 0.3 mM | |
2 | entity_2 | natural abundance | 0.3 mM | |
3 | entity_3 | natural abundance | 0.3 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % | |
6 | Na-PO4 | natural abundance | 20 mM | |
7 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity_1 | natural abundance | 0.5 mM | |
9 | entity_2 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
10 | entity_3 | natural abundance | 0.5 mM | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % | |
13 | Na-PO4 | natural abundance | 20 mM | |
14 | NaCl | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity_1 | natural abundance | 0.5 mM | |
16 | entity_2 | natural abundance | 0.5 mM | |
17 | entity_3 | [U-98% 13C; U-98% 15N] | 0.5 mM | |
18 | H2O | natural abundance | 93 % | |
19 | D2O | natural abundance | 7 % | |
20 | Na-PO4 | natural abundance | 20 mM | |
21 | NaCl | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18165_2lnh.nef |
Input source #2: Coordindates | 2lnh.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60----- GSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKN
---70--------80--------90-------100-------110-------120-------130-- GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEE --------10--------20--------30--------40--------50--------60-------
------140-------150-------160-------170--------- GLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP |||||||||||||||||||||||||||||||||||||||||||||||| GLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP --------10--------20--------30--------40--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 65 | 0 | 0 | 100.0 |
B | B | 67 | 0 | 0 | 100.0 |
C | C | 48 | 0 | 0 | 100.0 |
Content subtype: combined_18165_2lnh.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60----- GSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..NFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKN
---70--------80--------90-------100-------110-------120-------130-- GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEE ||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMK.QKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLE ---70--------80--------90-------100-------110-------120-------130-
------140-------150-------160-------170--------- GLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP |||||||||||||||||||||||||||||||||||||||||||||| .LPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSR ------140-------150-------160-------170--------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 390 | 371 | 95.1 |
13C chemical shifts | 289 | 210 | 72.7 |
15N chemical shifts | 73 | 63 | 86.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 135 | 127 | 94.1 |
13C chemical shifts | 130 | 63 | 48.5 |
15N chemical shifts | 63 | 58 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 255 | 244 | 95.7 |
13C chemical shifts | 159 | 147 | 92.5 |
15N chemical shifts | 10 | 5 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 32 | 100.0 |
13C chemical shifts | 32 | 32 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 34 | 100.0 |
13C chemical shifts | 33 | 23 | 69.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 418 | 375 | 89.7 |
13C chemical shifts | 316 | 221 | 69.9 |
15N chemical shifts | 70 | 60 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 137 | 125 | 91.2 |
13C chemical shifts | 134 | 63 | 47.0 |
15N chemical shifts | 64 | 56 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 281 | 250 | 89.0 |
13C chemical shifts | 182 | 158 | 86.8 |
15N chemical shifts | 6 | 4 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 34 | 97.1 |
13C chemical shifts | 35 | 34 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 38 | 92.7 |
13C chemical shifts | 39 | 27 | 69.2 |
15N chemical shifts | 2 | 2 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 296 | 255 | 86.1 |
13C chemical shifts | 211 | 153 | 72.5 |
15N chemical shifts | 50 | 35 | 70.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 88 | 80 | 90.9 |
13C chemical shifts | 96 | 45 | 46.9 |
15N chemical shifts | 38 | 34 | 89.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 208 | 175 | 84.1 |
13C chemical shifts | 115 | 108 | 93.9 |
15N chemical shifts | 12 | 1 | 8.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 23 | 23 | 100.0 |
13C chemical shifts | 23 | 23 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 12 | 12 | 100.0 |
13C chemical shifts | 11 | 11 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60----- GSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..NFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKN
---70--------80--------90-------100-------110-------120-------130-- GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEE |||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SHMK.QKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLE ---70--------80--------90-------100-------110-------120-------130-
------140-------150-------160-------170--------- GLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP ||||||||||||||||||||||||||||||||||||||||| ||| .LPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQ.EQS ------140-------150-------160-------170-------