Solution structure of GspC-HR of typeII secretion system
GSHMLEMAGA LDASQMSNLP PSTLNLSLTG VMAGDDDSRS IAIISKDNEQ FSRGVNEEVP GYNAKIVSIR PDRVVLQYQG RYEVLGLYSQ EDSGSDGVPG AQVR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 66.9 % (757 of 1131) | 68.8 % (404 of 587) | 63.8 % (277 of 434) | 69.1 % (76 of 110) |
Backbone | 67.8 % (416 of 614) | 68.2 % (146 of 214) | 67.1 % (202 of 301) | 68.7 % (68 of 99) |
Sidechain | 66.6 % (406 of 610) | 69.2 % (258 of 373) | 61.9 % (140 of 226) | 72.7 % (8 of 11) |
Aromatic | 26.1 % (12 of 46) | 52.2 % (12 of 23) | 0.0 % (0 of 23) | |
Methyl | 69.1 % (76 of 110) | 69.1 % (38 of 55) | 69.1 % (38 of 55) |
1. entity
GSHMLEMAGA LDASQMSNLP PSTLNLSLTG VMAGDDDSRS IAIISKDNEQ FSRGVNEEVP GYNAKIVSIR PDRVVLQYQG RYEVLGLYSQ EDSGSDGVPG AQVRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz MRC NMR centre UK
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.0, Details 0.5mM 15N 13C OutC-HRF3 20mM Tis pH7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OutC-HRF3 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | Tis | natural abundance | 20 mM | |
3 | D2O | natural abundance | 10 % | |
4 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, RDC restraints | combined_18181_2lnv.nef |
Input source #2: Coordindates | 2lnv.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
70-------80--------90-------100-------110-------120-------130-------140-------150-------160-------17 GSHMLEMAGALDASQMSNLPPSTLNLSLTGVMAGDDDSRSIAIISKDNEQFSRGVNEEVPGYNAKIVSIRPDRVVLQYQGRYEVLGLYSQEDSGSDGVPG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMLEMAGALDASQMSNLPPSTLNLSLTGVMAGDDDSRSIAIISKDNEQFSRGVNEEVPGYNAKIVSIRPDRVVLQYQGRYEVLGLYSQEDSGSDGVPG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0--- AQVR |||| AQVR ----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 104 | 0 | 0 | 100.0 |
Content subtype: combined_18181_2lnv.nef
Assigned chemical shifts
70-------80--------90-------100-------110-------120-------130-------140-------150-------160-------17 GSHMLEMAGALDASQMSNLPPSTLNLSLTGVMAGDDDSRSIAIISKDNEQFSRGVNEEVPGYNAKIVSIRPDRVVLQYQGRYEVLGLYSQEDSGSDGVPG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....................STLNLSLTGVMAGDDDSRSIAIISKDNEQFSRGVNEEVPGYNAKIVSIRPDRVVLQYQGRYEVLGL 70-------80--------90-------100-------110-------120-------130-------140-------150------ 0--- AQVR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
117 | ASN | CG | 31.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 587 | 364 | 62.0 |
13C chemical shifts | 434 | 259 | 59.7 |
15N chemical shifts | 116 | 72 | 62.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 214 | 136 | 63.6 |
13C chemical shifts | 208 | 129 | 62.0 |
15N chemical shifts | 99 | 64 | 64.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 373 | 228 | 61.1 |
13C chemical shifts | 226 | 130 | 57.5 |
15N chemical shifts | 17 | 8 | 47.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 36 | 61.0 |
13C chemical shifts | 59 | 37 | 62.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 23 | 12 | 52.2 |
13C chemical shifts | 23 | 0 | 0.0 |
Distance restraints
RDC restraints
70-------80--------90-------100-------110-------120-------130-------140-------150-------160-------17 GSHMLEMAGALDASQMSNLPPSTLNLSLTGVMAGDDDSRSIAIISKDNEQFSRGVNEEVPGYNAKIVSIRPDRVVLQYQGRYEVLGLYSQEDSGSDGVPG ||||| | |||||||| || || |||||||||| |||||| |||| | || | ||||||||||||||| | ...........DASQM.....S...LSLTGVMA.DD.SR..AIISKDNEQF.RGVNEE..GYNA.I..IR.D.VVLQYQGRYEVLGLY..E 70-------80--------90-------100-------110-------120-------130-------140-------150-------160 0--- AQVR