Solution structure of the Get5 carboxyl domain from A. fumigatus
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.6 % (786 of 849) | 88.4 % (390 of 441) | 97.0 % (321 of 331) | 97.4 % (75 of 77) |
Backbone | 96.8 % (428 of 442) | 95.4 % (144 of 151) | 97.7 % (215 of 220) | 97.2 % (69 of 71) |
Sidechain | 89.5 % (427 of 477) | 84.8 % (246 of 290) | 96.7 % (175 of 181) | 100.0 % (6 of 6) |
Aromatic | 100.0 % (80 of 80) | 100.0 % (40 of 40) | 100.0 % (38 of 38) | 100.0 % (2 of 2) |
Methyl | 92.9 % (65 of 70) | 88.6 % (31 of 35) | 97.1 % (34 of 35) |
1. Get5
SVDVAVSAGA GERASAEQKE SYEPPKPAVG PSGESVVATE AFWDDLQGFL EQRLKDYDEA NKLRVLFKEA WRSSFSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Get5 | [U-100% 15N] | 2.5 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | polyacrylamide | natural abundance | 5 % | |
10 | H2O | natural abundance | 90 % | |
11 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1, Details 20 mM sodium phosphate, 0.02% sodium azide, 0.1 mg/ml trimethylsilyl propanoic acid
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | Get5 | [U-100% 15N] | 2.5 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Get5 | natural abundance | 4 mM | |
18 | Get5 | [U-100% 13C; U-100% 15N] | 2 mM | |
19 | sodium phosphate | natural abundance | 20 mM | |
20 | sodium azide | natural abundance | 0.02 % | |
21 | H2O | natural abundance | 90 % | |
22 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.255145 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.255145 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.255145 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.255145 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Get5 | [U-100% 13C; U-100% 15N] | 3.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1, Details 20 mM sodium phosphate, 0.02% sodium azide, 0.1 mg/ml trimethylsilyl propanoic acid
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | Get5 | [U-100% 15N] | 2.5 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Get5 | [U-100% 15N] | 2.5 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | polyacrylamide | natural abundance | 5 % | |
10 | H2O | natural abundance | 90 % | |
11 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1, Details 20 mM sodium phosphate, 0.02% sodium azide, 0.1 mg/ml trimethylsilyl propanoic acid
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | Get5 | [U-100% 15N] | 2.5 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Get5 | natural abundance | 4 mM | |
18 | Get5 | [U-100% 13C; U-100% 15N] | 2 mM | |
19 | sodium phosphate | natural abundance | 20 mM | |
20 | sodium azide | natural abundance | 0.02 % | |
21 | H2O | natural abundance | 90 % | |
22 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18187_2lo0.nef |
Input source #2: Coordindates | 2lo0.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--160-------170-------180-------190-------200-------210-------220-------230 SVDVAVSAGAGERASAEQKESYEPPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SVDVAVSAGAGERASAEQKESYEPPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF --------10--------20--------30--------40--------50--------60--------70-----
--160-------170-------180-------190-------200-------210-------220-------230 SVDVAVSAGAGERASAEQKESYEPPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SVDVAVSAGAGERASAEQKESYEPPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF --------10--------20--------30--------40--------50--------60--------70-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 75 | 0 | 0 | 100.0 |
B | B | 75 | 0 | 0 | 100.0 |
Content subtype: combined_18187_2lo0.nef
Assigned chemical shifts
--160-------170-------180-------190-------200-------210-------220-------230 SVDVAVSAGAGERASAEQKESYEPPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .VDVAVSAGAGERASAEQKESYEPPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 441 | 378 | 85.7 |
13C chemical shifts | 331 | 321 | 97.0 |
15N chemical shifts | 81 | 75 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 151 | 143 | 94.7 |
13C chemical shifts | 150 | 146 | 97.3 |
15N chemical shifts | 71 | 69 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 290 | 235 | 81.0 |
13C chemical shifts | 181 | 175 | 96.7 |
15N chemical shifts | 10 | 6 | 60.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 29 | 82.9 |
13C chemical shifts | 35 | 34 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 40 | 100.0 |
13C chemical shifts | 38 | 38 | 100.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--160-------170-------180-------190-------200-------210-------220-------230 SVDVAVSAGAGERASAEQKESYEPPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF ||||||||||||||||||||||||||||||||||||||||||||| ..............................PSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF
--160-------170-------180-------190-------200-------210-------220-------230 SVDVAVSAGAGERASAEQKESYEPPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF ||||||||||||||||||||||||||||||||||||||||||||| ..............................PSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF
Dihedral angle restraints
--160-------170-------180-------190-------200-------210-------220-------230 SVDVAVSAGAGERASAEQKESYEPPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF ||||||||||||||||||||||||||||||||||||||||| ..................................SVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF
--160-------170-------180-------190-------200-------210-------220-------230 SVDVAVSAGAGERASAEQKESYEPPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF ||||||||||||||||||||||||||||||||||||||||| ..................................SVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF
RDC restraints