NMR STRUCTURE of Bcl-XL
MSQSNRELVV DFLSYKLSQK GYSWSQFSDV EENRTEAPEG TESEAVKQAL REAGDEFELR YRRAFSDLTS QLHITPGTAY QSFEQVVNEL FRDGVNWGRI VAFFSFGGAL CVESVDKEMQ VLVSRIAAWM ATYLNDHLEP WIQENGGWDT FVELYGNNAA AESRKGQERL EHHHHHHLEH HHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.0 % (1860 of 2162) | 84.4 % (943 of 1117) | 87.0 % (731 of 840) | 90.7 % (186 of 205) |
Backbone | 90.6 % (1000 of 1104) | 88.9 % (337 of 379) | 91.9 % (499 of 543) | 90.1 % (164 of 182) |
Sidechain | 82.8 % (1019 of 1231) | 82.1 % (606 of 738) | 83.2 % (391 of 470) | 95.7 % (22 of 23) |
Aromatic | 64.0 % (169 of 264) | 64.4 % (85 of 132) | 62.2 % (79 of 127) | 100.0 % (5 of 5) |
Methyl | 94.7 % (161 of 170) | 94.1 % (80 of 85) | 95.3 % (81 of 85) |
1. BCL-XL
MSQSNRELVV DFLSYKLSQK GYSWSQFSDV EENRTEAPEG TESEAVKQAL REAGDEFELR YRRAFSDLTS QLHITPGTAY QSFEQVVNEL FRDGVNWGRI VAFFSFGGAL CVESVDKEMQ VLVSRIAAWM ATYLNDHLEP WIQENGGWDT FVELYGNNAA AESRKGQERL EHHHHHHLEH HHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BCL-XL | [U-98% 13C; U-98% 15N] | 1.5 ~ 1.7 mM | |
2 | sodium phosphate | natural abundance | 5 mM | |
3 | 2-mercaptoethanol | natural abundance | 5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18250_2lpc.nef |
Input source #2: Coordindates | 2lpc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI -------110-------120-------130-------140-------150-------160-------170-------180----- VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHHLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHHLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 185 | 0 | 0 | 100.0 |
Content subtype: combined_18250_2lpc.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||| MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHIT.GTAYQSFEQVVNELFRDGVNWGRI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180----- VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHHLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLE -------110-------120-------130-------140-------150-------160-------170-
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
3 | GLN | CD | 179.57 |
5 | ASN | CG | 175.017 |
19 | GLN | CD | 179.723 |
26 | GLN | CD | 180.234 |
33 | ASN | CG | 177.044 |
48 | GLN | CD | 179.778 |
71 | GLN | CD | 179.83 |
81 | GLN | CD | 180.786 |
85 | GLN | CD | 180.219 |
88 | ASN | CG | 175.975 |
120 | GLN | CD | 179.85 |
135 | ASN | CG | 176.329 |
143 | GLN | CD | 180.135 |
167 | GLN | CD | 180.515 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1117 | 948 | 84.9 |
13C chemical shifts | 840 | 719 | 85.6 |
15N chemical shifts | 216 | 183 | 84.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 379 | 340 | 89.7 |
13C chemical shifts | 370 | 332 | 89.7 |
15N chemical shifts | 182 | 161 | 88.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 738 | 608 | 82.4 |
13C chemical shifts | 470 | 387 | 82.3 |
15N chemical shifts | 34 | 22 | 64.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 88 | 86 | 97.7 |
13C chemical shifts | 88 | 85 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 132 | 84 | 63.6 |
13C chemical shifts | 127 | 78 | 61.4 |
15N chemical shifts | 5 | 5 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||| MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHIT.GTAYQSFEQVVNELFRDGVNWGRI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180----- VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHHLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | | || VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAES.K.Q.RL -------110-------120-------130-------140-------150-------160-------170
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180----- VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHHLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEH -------110-------120-------130-------140-------150-------160-------170--