BMRBj - BMREntryMaster

Found 1 Document (0.687 seconds)

BMRB: 18263

2LPK

Solution NMR of the specialized apo-acyl carrier protein (RPA2022) from Rhodopseudomonas palustris, Northeast Structural Genomics Consortium Target RpR324

Authors

Ramelot, T.A., Rossi, P., Yang, Y., Lee, H., Ertekin, A., Wang, H., Ciccosanti, C., Kohan, E., Maglaqui, M., Janjua, H., Nair, R., Rost, B., Acton, T.B., Xiao, R.A., Everett, J.K., Prestegard, J.H., Montelione, G.T., Kennedy, M.A.

Assembly

RPA2022

Entity

1. RPA2022 (polymer, Thiol state: all free), 101 monomers, 11293.58 Da Detail

MTSTFDRVAT IIAETCDIPR ETITPESHAI DDLGIDSLDF LDIAFAIDKA FGIKLPLEKW TQEVNDGKAT TEQYFVLKNL AARIDELVAA KGALEHHHHH H

Formula weight

11293.58 Da

Source organism

Rhodopseudomonas palustris

Exptl. method

solution NMR

Refine. method

simulated annealing

Data set

assigned_chemical_shifts, spectral_peak_list

Chem. Shift Complete

Sequence coverage: 95.0 %, Completeness: 93.5 %, Completeness (bb): 93.5 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	93.5 % (1080 of 1155)	93.7 % (552 of 589)	93.3 % (432 of 463)	93.2 % (96 of 103)
Backbone	93.5 % (561 of 600)	93.6 % (190 of 203)	93.6 % (280 of 299)	92.9 % (91 of 98)
Sidechain	93.7 % (611 of 652)	93.8 % (362 of 386)	93.5 % (244 of 261)	100.0 % (5 of 5)
Aromatic	75.5 % (74 of 98)	75.5 % (37 of 49)	75.0 % (36 of 48)	100.0 % (1 of 1)
Methyl	100.0 % (134 of 134)	100.0 % (67 of 67)	100.0 % (67 of 67)

1. entity

MTSTFDRVAT IIAETCDIPR ETITPESHAI DDLGIDSLDF LDIAFAIDKA FGIKLPLEKW TQEVNDGKAT TEQYFVLKNL AARIDELVAA KGALEHHHHH H

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
10	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
11	MES	natural abundance	20 (±1.0) mM
12	sodium chloride	natural abundance	200 (±5.0) mM
13	calcium chloride	natural abundance	5 (±0.25) mM
14	sodium azide	natural abundance	0.02 (±0.001) %
15	DTT	natural abundance	10 (±0.5) mM
16	DSS	natural abundance	5 (±0.25) uM
17	D2O	natural abundance	100 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.22 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.22 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.0 ppm, Outliers: 5 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.71 ppm, Outliers: 3 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2LPK, Strand ID: A Detail

Release date

2012-03-18

Citation

Solution NMR structure of the specialized apo-acyl carrier protein RPA2022 from Rhodopseudomonas palustris refined with NH RDCs. Northeast Structural Genomics Consortium Target RpR324
Ramelot, T., Rossi, P.A., Forouhar, F., Lee, H., Yang, Y., Ni, S., Unser, S., Lew, S., Seetharaman, J., Xiao, R., Acton, T.B., Everett, J.K., Prestegard, J.H., Hunt, J.F., Montelione, G.T., Kennedy, M.A.
Not known

Related entities 1. RPA2022, : 1 : 4 : 18 entities Detail

Experiments performed 12 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker AvanceIII - 850 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

2 2D 1H-13C HSQC aliphatic

Instrument

Bruker AvanceIII - 850 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

3 2D 1H-13C HSQC aromatic

Instrument

Bruker AvanceIII - 850 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

4 2D 1H-15N HSQC

Instrument

Bruker AvanceIII - 850 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
10	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
11	MES	natural abundance	20 (±1.0) mM
12	sodium chloride	natural abundance	200 (±5.0) mM
13	calcium chloride	natural abundance	5 (±0.25) mM
14	sodium azide	natural abundance	0.02 (±0.001) %
15	DTT	natural abundance	10 (±0.5) mM
16	DSS	natural abundance	5 (±0.25) uM
17	D2O	natural abundance	100 %

5 3D 1H-15N NOESY

Instrument

Bruker AvanceIII - 850 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

6 3D 1H-13C NOESY_aliph

Instrument

Bruker AvanceIII - 850 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

7 3D 1H-13C NOESY_arom

Instrument

Bruker AvanceIII - 850 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

8 2D 1H-15N hetNOE

Instrument

Bruker AvanceIII - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

9 2D 1H-15N T1

Instrument

Bruker AvanceIII - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

10 2D 1H-15N T2

Instrument

Bruker AvanceIII - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

11 1D 15N T1

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

12 1D 15N T2

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)

#	Name	Isotope labeling	Concentration
1	protein	[U-100% 13C; U-100% 15N]	1.0 (±0.1) mM
2	MES	natural abundance	20 (±1.0) mM
3	sodium chloride	natural abundance	200 (±5.0) mM
4	calcium chloride	natural abundance	5 (±0.25) mM
5	sodium azide	natural abundance	0.02 (±0.001) %
6	DTT	natural abundance	10 (±0.5) mM
7	DSS	natural abundance	5 (±0.25) uM
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

NMR combined restraints 8 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints	combined_18263_2lpk.nef
Input source #2: Coordindates	2lpk.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHH
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHH

-
H
|
H

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	101	0	0	100.0

Content subtype: combined_18263_2lpk.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1092		95.0 (chain: A, length: 101)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	2245 (1)	noe	94.1 (chain: A, length: 101)
2	Distance restraints	CNS/XPLOR_distance_constraints_7	OK	2260 (1)	noe	94.1 (chain: A, length: 101)
3	Distance restraints	CNS/XPLOR_distance_constraints_6	OK	94 (1)	hbond	65.3 (chain: A, length: 101)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_3	OK	144 (144)	.	87.1 (chain: A, length: 101)
1	RDC restraints	CNS/XPLOR_dipolar_coupling_4	OK	58 (58)	.	57.4 (chain: A, length: 101)
2	RDC restraints	CNS/XPLOR_dipolar_coupling_5	OK	73 (73)	.	72.3 (chain: A, length: 101)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 95.0%
- Total number of assignments
  - ¹H chemical shifts: 554
  - ¹³C chemical shifts: 436
  - ¹⁵N chemical shifts: 102
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
20	ARG	HH11	6.78
20	ARG	HH12	6.78
20	ARG	NH1	72.0
28	HIS	ND1	247.1
28	HIS	NE2	165.1
62	GLN	CD	180.7
65	ASN	CG	176.0
73	GLN	CD	180.2
79	ASN	CG	175.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	589	552	93.7
¹³C chemical shifts	463	432	93.3
¹⁵N chemical shifts	106	99	93.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	203	190	93.6
¹³C chemical shifts	202	188	93.1
¹⁵N chemical shifts	98	91	92.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	386	362	93.8
¹³C chemical shifts	261	244	93.5
¹⁵N chemical shifts	8	8	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	68	68	100.0
¹³C chemical shifts	68	68	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	49	37	75.5
¹³C chemical shifts	48	36	75.0
¹⁵N chemical shifts	1	1	100.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 94.1%
- Total number of restraints: 2241
- Weight of restraints: 1.0 (2241)
- Potential type of restraints: square-well-parabolic (2241)
- Range of distance target values: 2.25, 3.9 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_7
  - Status: OK
  - Experiment type: noe
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 94.1%
  - Total number of restraints: 2257
  - Weight of restraints: 1.0 (2257)
  - Potential type of restraints: square-well-parabolic (2257)
  - Range of distance target values: 2.25, 3.9 (Å)
  - Histogram of distance target values
  - Histogram of discrepancy in distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map
  - Saveframe: CNS/XPLOR_distance_constraints_6
    - Status: OK
    - Experiment type: hbond
    - Sequence coverage of experimental data
      - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 65.3%
    - Total number of restraints: 94
    - Weight of restraints: 1.0 (94)
    - Potential type of restraints: square-well-parabolic (94)
    - Range of distance target values: 2.0, 3.0 (Å)
    - Histogram of distance target values
    - Distance restraints per residue
      - Chain_ID: A
    - Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 87.1%
- Total number of restraints: 144
- Total number of restraints per polymer type: 144
- Weight of restraints: 1.0 (144)
- Potential type of restraints: square-well-parabolic (144)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

RDC restraints

Saveframe: CNS/XPLOR_dipolar_coupling_4

Status: OK
Experiment type: .

Sequence coverage of experimental data

Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 57.4%

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHH
      |||||||||||| ||||  |||||  || | |     ||   ||||    |||  |  ||| || ||||| || || |||||||||        
......RVATIIAETCDI.RETI..ESHAI..LG.D.L.....AF...KAFG....LEK..Q..NDG.AT.EQYFV.KN.AA.IDELVAAKG        
--------10--------20--------30--------40--------50--------60--------70--------80--------90--        

-
H

Total number of restraints: 58
Potential type of restraints: undefined (58)
Range of observed RDC values: 100.0, -100.0 (Hz)
RDC restraints per residue
- Chain_ID: A
  None

Saveframe: CNS/XPLOR_dipolar_coupling_5

Status: OK
Experiment type: .

Sequence coverage of experimental data

Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 72.3%

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHH
      |||||||||||| ||||  ||||| ||||||   || ||| ||||||   ||| ||||||||||||||||||||||||||||||||        
......RVATIIAETCDI.RETI..ESHAI.DLGIDS...LD.AFA.DKAFGI...LEK.TQEVNDGKATTEQYFVLKNLAARIDELVAAKG        
--------10--------20--------30--------40--------50--------60--------70--------80--------90--        

-
H

Total number of restraints: 73
Potential type of restraints: undefined (73)
Range of observed RDC values: 100.0, -100.0 (Hz)
RDC restraints per residue
- Chain_ID: A
  None

Keywords AcpXL, acyl carrier protein, apo, Northeast Structural Genomics Consortium, Protein Structure Initiative, PSI-Biology, RpAcpXL, Structural Genomics

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.687 seconds)

BMRB: 18263

Sample #1

Sample #2

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. RPA2022, : 1 : 4 : 18 entities Detail

Experiments performed 12 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 8 contents Detail