MIC5 regulates the activity of Toxoplasma subtilisin 1 by mimicking a subtilisin prodomain
Polymer type: polypeptide(L)
Total | 1H | |
---|---|---|
All | 93.9 % (138 of 147) | 93.9 % (138 of 147) |
Backbone | 100.0 % (62 of 62) | 100.0 % (62 of 62) |
Sidechain | 89.4 % (76 of 85) | 89.4 % (76 of 85) |
Aromatic | 63.2 % (12 of 19) | 63.2 % (12 of 19) |
Methyl | 90.0 % (9 of 10) | 90.0 % (9 of 10) |
1. Tg Micronemal Protein 5
CGETCVGGTC NTPGCTCSWP VCGHFRWGVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance II - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tg Micronemal Protein 5 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18506_2lu2.nef |
Input source #2: Coordindates | 2lu2.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RTMDTQNDVESAGRQSEPMEAADRQAEHPGAPTQSEMKEFQEEIKEGVEETKHEGDPEMTRLMVTEKQESKNFSKMAKSQSFSTRIEELGGSISFLTETG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RTMDTQNDVESAGRQSEPMEAADRQAEHPGAPTQSEMKEFQEEIKEGVEETKHEGDPEMTRLMVTEKQESKNFSKMAKSQSFSTRIEELGGSISFLTETG -------110-------120-------130-------- VTMIELPKTVSEHDMDQLLHDILAAGGVVGLDSEVKLA |||||||||||||||||||||||||||||||||||||| VTMIELPKTVSEHDMDQLLHDILAAGGVVGLDSEVKLA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 138 | 0 | 0 | 100.0 |
Content subtype: combined_18506_2lu2.nef
Assigned chemical shifts
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RTMDTQNDVESAGRQSEPMEAADRQAEHPGAPTQSEMKEFQEEIKEGVEETKHEGDPEMTRLMVTEKQESKNFSKMAKSQSFSTRIEELGGSISFLTETG |||||||||||||||||||||| |||||||||||||||||||| .........................................................EMTRLMVTEKQESKNFSKMAKS.SFSTRIEELGGSISFLTETG -------110-------120-------130-------- VTMIELPKTVSEHDMDQLLHDILAAGGVVGLDSEVKLA |||||||||||||||||||||||||||||||||||||| VTMIELPKTVSEHDMDQLLHDILAAGGVVGLDSEVKLA
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RTMDTQNDVESAGRQSEPMEAADRQAEHPGAPTQSEMKEFQEEIKEGVEETKHEGDPEMTRLMVTEKQESKNFSKMAKSQSFSTRIEELGGSISFLTETG ||||||||||||||||||||||||||||||||||||||||||| .........................................................EMTRLMVTEKQESKNFSKMAKSQSFSTRIEELGGSISFLTETG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------- VTMIELPKTVSEHDMDQLLHDILAAGGVVGLDSEVKLA |||||||||||||||||||||||||||||||||||| VTMIELPKTVSEHDMDQLLHDILAAGGVVGLDSEVK -------110-------120-------130------