Solution NMR structure of the p300 Taz2:ETAD1 complex
GSATQSPGDS RRLSIQRAIQ SLVHAAQCRN ANCSLPSCQK MKRVVQHTKG CKRKTNGGCP ICKQLIALAA YHAKHCQENK CPVPFCLNIK QK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.5 % (1411 of 1509) | 89.9 % (721 of 802) | 97.5 % (554 of 568) | 97.8 % (136 of 139) |
Backbone | 96.6 % (740 of 766) | 95.4 % (249 of 261) | 97.1 % (373 of 384) | 97.5 % (118 of 121) |
Sidechain | 91.9 % (795 of 865) | 87.4 % (473 of 541) | 99.3 % (304 of 306) | 100.0 % (18 of 18) |
Aromatic | 100.0 % (54 of 54) | 100.0 % (27 of 27) | 100.0 % (27 of 27) | |
Methyl | 98.2 % (112 of 114) | 96.5 % (55 of 57) | 100.0 % (57 of 57) |
1. ETAD1
GSMNQPQRMA PVGTDKELSD LLDFSMMFPL PVTNGKGRP2. Taz2
GSATQSPGDS RRLSIQRAIQ SLVHAAQCRN ANCSLPSCQK MKRVVQHTKG CKRKTNGGCP ICKQLIALAA YHAKHCQENK CPVPFCLNIK QKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled ETAD1, unlabeled Taz2 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETAD1 | [U-99% 13C; U-99% 15N] | 1.4 mM | |
2 | Taz2 | natural abundance | 2 mM | |
3 | MES | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | beta-mercaptoethanol | natural abundance | 5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled Taz2 Unlabeled ETAD1 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ETAD1 | natural abundance | 3078 uM | |
9 | Taz2 | [U-99% 13C; U-99% 15N] | 1038 uM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | beta-mercaptoethanol | natural abundance | 5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.85 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.85 ppm | internal | direct | 1.0 |
15N | water | protons | 4.85 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.85 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.85 ppm | internal | direct | 1.0 |
15N | water | protons | 4.85 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.85 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.85 ppm | internal | direct | 1.0 |
15N | water | protons | 4.85 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.85 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.85 ppm | internal | direct | 1.0 |
15N | water | protons | 4.85 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled ETAD1, unlabeled Taz2 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETAD1 | [U-99% 13C; U-99% 15N] | 1.4 mM | |
2 | Taz2 | natural abundance | 2 mM | |
3 | MES | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | beta-mercaptoethanol | natural abundance | 5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled ETAD1, unlabeled Taz2 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETAD1 | [U-99% 13C; U-99% 15N] | 1.4 mM | |
2 | Taz2 | natural abundance | 2 mM | |
3 | MES | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | beta-mercaptoethanol | natural abundance | 5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled ETAD1, unlabeled Taz2 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETAD1 | [U-99% 13C; U-99% 15N] | 1.4 mM | |
2 | Taz2 | natural abundance | 2 mM | |
3 | MES | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | beta-mercaptoethanol | natural abundance | 5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled ETAD1, unlabeled Taz2 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETAD1 | [U-99% 13C; U-99% 15N] | 1.4 mM | |
2 | Taz2 | natural abundance | 2 mM | |
3 | MES | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | beta-mercaptoethanol | natural abundance | 5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled ETAD1, unlabeled Taz2 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETAD1 | [U-99% 13C; U-99% 15N] | 1.4 mM | |
2 | Taz2 | natural abundance | 2 mM | |
3 | MES | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | beta-mercaptoethanol | natural abundance | 5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled ETAD1, unlabeled Taz2 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETAD1 | [U-99% 13C; U-99% 15N] | 1.4 mM | |
2 | Taz2 | natural abundance | 2 mM | |
3 | MES | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | beta-mercaptoethanol | natural abundance | 5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz QANUC
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled ETAD1, unlabeled Taz2 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETAD1 | [U-99% 13C; U-99% 15N] | 1.4 mM | |
2 | Taz2 | natural abundance | 2 mM | |
3 | MES | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | beta-mercaptoethanol | natural abundance | 5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz QANUC
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled ETAD1, unlabeled Taz2 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETAD1 | [U-99% 13C; U-99% 15N] | 1.4 mM | |
2 | Taz2 | natural abundance | 2 mM | |
3 | MES | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | beta-mercaptoethanol | natural abundance | 5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz QANUC
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled ETAD1, unlabeled Taz2 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETAD1 | [U-99% 13C; U-99% 15N] | 1.4 mM | |
2 | Taz2 | natural abundance | 2 mM | |
3 | MES | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | beta-mercaptoethanol | natural abundance | 5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled Taz2 Unlabeled ETAD1 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ETAD1 | natural abundance | 3078 uM | |
9 | Taz2 | [U-99% 13C; U-99% 15N] | 1038 uM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | beta-mercaptoethanol | natural abundance | 5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled Taz2 Unlabeled ETAD1 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ETAD1 | natural abundance | 3078 uM | |
9 | Taz2 | [U-99% 13C; U-99% 15N] | 1038 uM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | beta-mercaptoethanol | natural abundance | 5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled Taz2 Unlabeled ETAD1 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ETAD1 | natural abundance | 3078 uM | |
9 | Taz2 | [U-99% 13C; U-99% 15N] | 1038 uM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | beta-mercaptoethanol | natural abundance | 5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled Taz2 Unlabeled ETAD1 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ETAD1 | natural abundance | 3078 uM | |
9 | Taz2 | [U-99% 13C; U-99% 15N] | 1038 uM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | beta-mercaptoethanol | natural abundance | 5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled Taz2 Unlabeled ETAD1 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ETAD1 | natural abundance | 3078 uM | |
9 | Taz2 | [U-99% 13C; U-99% 15N] | 1038 uM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | beta-mercaptoethanol | natural abundance | 5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled Taz2 Unlabeled ETAD1 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ETAD1 | natural abundance | 3078 uM | |
9 | Taz2 | [U-99% 13C; U-99% 15N] | 1038 uM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | beta-mercaptoethanol | natural abundance | 5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz QANUC
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled Taz2 Unlabeled ETAD1 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ETAD1 | natural abundance | 3078 uM | |
9 | Taz2 | [U-99% 13C; U-99% 15N] | 1038 uM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | beta-mercaptoethanol | natural abundance | 5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz QANUC
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled Taz2 Unlabeled ETAD1 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ETAD1 | natural abundance | 3078 uM | |
9 | Taz2 | [U-99% 13C; U-99% 15N] | 1038 uM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | beta-mercaptoethanol | natural abundance | 5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz QANUC
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5, Details Labeled Taz2 Unlabeled ETAD1 pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ETAD1 | natural abundance | 3078 uM | |
9 | Taz2 | [U-99% 13C; U-99% 15N] | 1038 uM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | beta-mercaptoethanol | natural abundance | 5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19610_2mh0.nef |
Input source #2: Coordindates | 2mh0.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30------- GSMNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRP ||||||||||||||||||||||||||||||||||||||| GSMNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRP --------10--------20--------30---------
------1730------1740------1750------1760------1770------1780------1790------1800------1810-- GSATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK --------10--------20--------30--------40--------50--------60--------70--------80--------90--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 39 | 0 | 0 | 100.0 |
B | B | 92 | 0 | 0 | 100.0 |
Content subtype: combined_19610_2mh0.nef
Assigned chemical shifts
-0--------10--------20--------30------- GSMNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRP ||||||||||||||||||||||||||||||||||||||| GSMNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRP
------1730------1740------1750------1760------1770------1780------1790------1800------1810-- GSATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
2 | ASN | CG | 176.993 |
3 | GLN | CD | 180.485 |
5 | GLN | CD | 180.45 |
32 | ASN | CG | 177.014 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 238 | 212 | 89.1 |
13C chemical shifts | 172 | 168 | 97.7 |
15N chemical shifts | 40 | 36 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 71 | 92.2 |
13C chemical shifts | 78 | 76 | 97.4 |
15N chemical shifts | 34 | 32 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 161 | 141 | 87.6 |
13C chemical shifts | 94 | 92 | 97.9 |
15N chemical shifts | 6 | 4 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 19 | 17 | 89.5 |
13C chemical shifts | 19 | 17 | 89.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 10 | 10 | 100.0 |
13C chemical shifts | 10 | 10 | 100.0 |
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
1768 | THR | HG1 | 5.517 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 564 | 508 | 90.1 |
13C chemical shifts | 396 | 386 | 97.5 |
15N chemical shifts | 107 | 98 | 91.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 184 | 178 | 96.7 |
13C chemical shifts | 184 | 174 | 94.6 |
15N chemical shifts | 87 | 84 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 380 | 330 | 86.8 |
13C chemical shifts | 212 | 212 | 100.0 |
15N chemical shifts | 20 | 14 | 70.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 43 | 100.0 |
13C chemical shifts | 43 | 43 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 17 | 100.0 |
13C chemical shifts | 17 | 17 | 100.0 |
Distance restraints
-0--------10--------20--------30------- GSMNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRP ||||||||||||||||||||||||||||||||||||| ..MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRP
------1730------1740------1750------1760------1770------1780------1790------1800------1810-- GSATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK
------1730------1740------1750------1760------1770------1780------1790------1800------1810-- GSATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK ||||||||||||||||||||| ||||||||||||||| | | ||||||||||||||| |||||||| ......PGDSRRLSIQRAIQSLVHAAQ........PSCQKMKRVVQHTKG.K...N...PICKQLIALAAYHAK.........PFCLNIKQ ------1730------1740------1750------1760------1770------1780------1790------1800------1810-