HIFABP_Ketorolac_complex
AFDSTWKVDR SENYDKFMEK MGVNIVKRKL AAHDNLKLTI TQEGNKFTVK ESSAFRNIEV VFELGVTFNY NLADGTELRG TWSLEGNKLI GKFKRTDNGN ELNTVREIIG DELVQTYVYE GVEAKRIFKK D
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.5 % (1269 of 1576) | 83.1 % (682 of 821) | 75.7 % (461 of 609) | 86.3 % (126 of 146) |
Backbone | 81.7 % (642 of 786) | 91.2 % (248 of 272) | 70.2 % (269 of 383) | 95.4 % (125 of 131) |
Sidechain | 81.4 % (742 of 911) | 79.1 % (434 of 549) | 88.5 % (307 of 347) | 6.7 % (1 of 15) |
Aromatic | 71.4 % (100 of 140) | 72.9 % (51 of 70) | 70.6 % (48 of 68) | 50.0 % (1 of 2) |
Methyl | 90.3 % (130 of 144) | 88.9 % (64 of 72) | 91.7 % (66 of 72) |
1. HIFABP
AFDSTWKVDR SENYDKFMEK MGVNIVKRKL AAHDNLKLTI TQEGNKFTVK ESSAFRNIEV VFELGVTFNY NLADGTELRG TWSLEGNKLI GKFKRTDNGN ELNTVREIIG DELVQTYVYE GVEAKRIFKK DSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIFABP | [U-13C; U-15N] | 1 mM | |
2 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HIFABP | [U-13C; U-15N] | 0.5 mM | |
8 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 5 mM | |
9 | NaCl | natural abundance | 50 mM | |
10 | MES | natural abundance | 20 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | HIFABP | [U-13C; U-15N] | 0.25 mM | |
14 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 2.5 mM | |
15 | NaCl | natural abundance | 50 mM | |
16 | MES | natural abundance | 20 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | HIFABP | [U-13C; U-15N] | 0.25 mM | |
14 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 2.5 mM | |
15 | NaCl | natural abundance | 50 mM | |
16 | MES | natural abundance | 20 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | HIFABP | [U-13C; U-15N] | 0.25 mM | |
14 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 2.5 mM | |
15 | NaCl | natural abundance | 50 mM | |
16 | MES | natural abundance | 20 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HIFABP | [U-13C; U-15N] | 0.5 mM | |
8 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 5 mM | |
9 | NaCl | natural abundance | 50 mM | |
10 | MES | natural abundance | 20 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HIFABP | [U-13C; U-15N] | 0.5 mM | |
8 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 5 mM | |
9 | NaCl | natural abundance | 50 mM | |
10 | MES | natural abundance | 20 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIFABP | [U-13C; U-15N] | 1 mM | |
2 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIFABP | [U-13C; U-15N] | 1 mM | |
2 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIFABP | [U-13C; U-15N] | 1 mM | |
2 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HIFABP | [U-13C; U-15N] | 0.5 mM | |
8 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 5 mM | |
9 | NaCl | natural abundance | 50 mM | |
10 | MES | natural abundance | 20 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HIFABP | [U-13C; U-15N] | 0.5 mM | |
8 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 5 mM | |
9 | NaCl | natural abundance | 50 mM | |
10 | MES | natural abundance | 20 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HIFABP | [U-13C; U-15N] | 0.5 mM | |
8 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 5 mM | |
9 | NaCl | natural abundance | 50 mM | |
10 | MES | natural abundance | 20 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5, Details 20 mM MES, 50 mM NaCl, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIFABP | [U-13C; U-15N] | 1 mM | |
2 | 5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19727_2mji.nef |
Input source #2: Coordindates | 2mji.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | KTR | (1R)-5-benzoyl-2,3-dihydro-1H-pyrrolizine-1-carboxylic acid | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN -------110-------120-------130- ELNTVREIIGDELVQTYVYEGVEAKRIFKKD ||||||||||||||||||||||||||||||| ELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 131 | 0 | 0 | 100.0 |
Content subtype: combined_19727_2mji.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN ||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||| |||||||||||||||||||||||||||| AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAF.NIEVVFELGVTFNY..ADGTELRGTWSLEGNKLIGKFKRTDNGN -------110-------120-------130- ELNTVREIIGDELVQTYVYEGVEAKRIFKKD ||||||||||||||||||||||||||||||| ELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 821 | 693 | 84.4 |
13C chemical shifts | 609 | 434 | 71.3 |
15N chemical shifts | 153 | 126 | 82.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 272 | 252 | 92.6 |
13C chemical shifts | 262 | 126 | 48.1 |
15N chemical shifts | 131 | 125 | 95.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 549 | 441 | 80.3 |
13C chemical shifts | 347 | 308 | 88.8 |
15N chemical shifts | 22 | 1 | 4.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 68 | 91.9 |
13C chemical shifts | 74 | 68 | 91.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 51 | 72.9 |
13C chemical shifts | 68 | 48 | 70.6 |
15N chemical shifts | 2 | 1 | 50.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN |||||||||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||| |||||||||||||||||||||||||| AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKES.AF.NIEVVFELGVTFNY....GTELRGTWSLEGNKLIGKFKRTDNGN -------110-------120-------130- ELNTVREIIGDELVQTYVYEGVEAKRIFKKD ||||||||||||||||||||||||||||||| ELNTVREIIGDELVQTYVYEGVEAKRIFKKD
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN | ||||| |||||||||||||| || | |||||| | |||||||| | | ||||| | | | | |||||| | |||||||| | ...S.WKVDR.ENYDKFMEKMGVNI..RK..A...LKLTIT.E.NKFTVKES.....I.V.FELGV.F.Y.L...T.LRGTWS.E..KLIGKFKR....N --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130- ELNTVREIIGDELVQTYVYEGVEAKRIFKKD ||||||| | ||||||||| | |||||| ELNTVRE.I..ELVQTYVYE.V.AKRIFK -------110-------120---------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN ||||||||||||||||||||| ||||||||||| ||||||| ||||||||||||||||||||||| |||| |||||||||||||||||||| | AFDSTWKVDRSENYDKFMEKM.VNIVKRKLAAH.NLKLTIT.EGNKFTVKESSAFRNIEVVFELG.TFNY.......LRGTWSLEGNKLIGKFKRTD..N -------110-------120-------130- ELNTVREIIGDELVQTYVYEGVEAKRIFKKD |||||||| |||||||||||||||||||||| ELNTVREI.GDELVQTYVYEGVEAKRIFKKD