Cooperative Structure of the Heterotrimeric pre-mRNA Retention and Splicing Complex
GAMGNEYKDN AYIYIGNLNR ELTEGDILTV FSEYGVPVDV ILSRDENTGE SQGFAYLKYE DQRSTILAVD NLNGFKIGGR ALKIDHTFYR PKRSLQKYYE AVKEELDRDI VSKNNAEK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.2 % (1902 of 2040) | 94.9 % (1013 of 1068) | 90.4 % (712 of 788) | 96.2 % (177 of 184) |
Backbone | 92.9 % (957 of 1030) | 98.3 % (351 of 357) | 87.5 % (443 of 506) | 97.6 % (163 of 167) |
Sidechain | 94.3 % (1102 of 1168) | 93.1 % (662 of 711) | 96.8 % (426 of 440) | 82.4 % (14 of 17) |
Aromatic | 92.1 % (175 of 190) | 92.6 % (88 of 95) | 91.4 % (85 of 93) | 100.0 % (2 of 2) |
Methyl | 100.0 % (156 of 156) | 100.0 % (78 of 78) | 100.0 % (78 of 78) |
1. Snu17p
GAMGNEYKDN AYIYIGNLNR ELTEGDILTV FSEYGVPVDV ILSRDENTGE SQGFAYLKYE DQRSTILAVD NLNGFKIGGR ALKIDHTFYR PKRSLQKYYE AVKEELDRDI VSKNNAEK2. Pml1p
GSKSQYIDIM PDFSPSGLLE LES3. Bud13p
GSYDKPAPEN RFAIMPGSRW DGVHRSNGFE EKWSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
25 | sodium phosphate | natural abundance | 25 mM | |
26 | NaCl | natural abundance | 250 mM | |
27 | sodium azide | natural abundance | 1 mM | |
28 | Snu17p | [U-13C; U-15N; U-2H] | 0.9 ~ 1.3 mM | |
29 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
30 | Pml1p | natural abundance | 1.4 ~ 1.9 mM | |
31 | H2O | natural abundance | 90 % | |
32 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
33 | sodium phosphate | natural abundance | 25 mM | |
34 | NaCl | natural abundance | 250 mM | |
35 | sodium azide | natural abundance | 1 mM | |
36 | Snu17p | [U-13C; U-15N; U-2H] | 1.0 ~ 1.3 mM | |
37 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
38 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
39 | H2O | natural abundance | 90 % | |
40 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
25 | sodium phosphate | natural abundance | 25 mM | |
26 | NaCl | natural abundance | 250 mM | |
27 | sodium azide | natural abundance | 1 mM | |
28 | Snu17p | [U-13C; U-15N; U-2H] | 0.9 ~ 1.3 mM | |
29 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
30 | Pml1p | natural abundance | 1.4 ~ 1.9 mM | |
31 | H2O | natural abundance | 90 % | |
32 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
33 | sodium phosphate | natural abundance | 25 mM | |
34 | NaCl | natural abundance | 250 mM | |
35 | sodium azide | natural abundance | 1 mM | |
36 | Snu17p | [U-13C; U-15N; U-2H] | 1.0 ~ 1.3 mM | |
37 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
38 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
39 | H2O | natural abundance | 90 % | |
40 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
33 | sodium phosphate | natural abundance | 25 mM | |
34 | NaCl | natural abundance | 250 mM | |
35 | sodium azide | natural abundance | 1 mM | |
36 | Snu17p | [U-13C; U-15N; U-2H] | 1.0 ~ 1.3 mM | |
37 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
38 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
39 | H2O | natural abundance | 90 % | |
40 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
33 | sodium phosphate | natural abundance | 25 mM | |
34 | NaCl | natural abundance | 250 mM | |
35 | sodium azide | natural abundance | 1 mM | |
36 | Snu17p | [U-13C; U-15N; U-2H] | 1.0 ~ 1.3 mM | |
37 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
38 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
39 | H2O | natural abundance | 90 % | |
40 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 25 mM | |
10 | NaCl | natural abundance | 250 mM | |
11 | sodium azide | natural abundance | 1 mM | |
12 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
13 | Bud13p | natural abundance | 1.2 ~ 1.5 mM | |
14 | Pml1p | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz RT probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | NaCl | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | Snu17p | [U-13C; U-15N] | 0.9 ~ 1.3 mM | |
5 | Bud13p | natural abundance | 1.1 ~ 1.5 mM | |
6 | Pml1p | natural abundance | 1.4 ~ 19.0 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | sodium phosphate | natural abundance | 25 mM | |
18 | NaCl | natural abundance | 250 mM | |
19 | sodium azide | natural abundance | 1 mM | |
20 | Snu17p | natural abundance | 1.0 ~ 1.3 mM | |
21 | Bud13p | [U-10% 13C; U-99% 15N] | 0.8 ~ 1.0 mM | |
22 | Pml1p | natural abundance | 1.5 ~ 1.9 mM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19766_2mkc.nef |
Input source #2: Coordindates | 2mkc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE -------110-------- AVKEELDRDIVSKNNAEK |||||||||||||||||| AVKEELDRDIVSKNNAEK
200-----210-------220-- GSKSQYIDIMPDFSPSGLLELES ||||||||||||||||||||||| GSKSQYIDIMPDFSPSGLLELES --------10--------20---
300-----310-------320-------330-- GSYDKPAPENRFAIMPGSRWDGVHRSNGFEEKW ||||||||||||||||||||||||||||||||| GSYDKPAPENRFAIMPGSRWDGVHRSNGFEEKW --------10--------20--------30---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 118 | 0 | 0 | 100.0 |
B | B | 23 | 0 | 0 | 100.0 |
C | C | 33 | 0 | 0 | 100.0 |
Content subtype: combined_19766_2mkc.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE -------110-------- AVKEELDRDIVSKNNAEK |||||||||||||||||| AVKEELDRDIVSKNNAEK
200-----210-------220-- GSKSQYIDIMPDFSPSGLLELES ||||||||||||||||||||||| GSKSQYIDIMPDFSPSGLLELES
300-----310-------320-------330-- GSYDKPAPENRFAIMPGSRWDGVHRSNGFEEKW ||||||||||||||||||||||||||||||||| GSYDKPAPENRFAIMPGSRWDGVHRSNGFEEKW
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
23 | THR | HG1 | 5.468 |
29 | THR | HG1 | 5.102 |
32 | SER | HG | 6.106 |
44 | ARG | HH12 | 6.892 |
44 | ARG | NH1 | 70.398 |
64 | SER | HG | 5.788 |
73 | ASN | CG | 176.907 |
96 | GLN | CD | 179.956 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 724 | 690 | 95.3 |
13C chemical shifts | 536 | 510 | 95.1 |
15N chemical shifts | 135 | 121 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 244 | 240 | 98.4 |
13C chemical shifts | 236 | 222 | 94.1 |
15N chemical shifts | 116 | 112 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 480 | 450 | 93.8 |
13C chemical shifts | 300 | 288 | 96.0 |
15N chemical shifts | 19 | 9 | 47.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 63 | 100.0 |
13C chemical shifts | 63 | 63 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 54 | 93.1 |
13C chemical shifts | 58 | 52 | 89.7 |
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
215 | SER | HG | 6.962 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 137 | 127 | 92.7 |
13C chemical shifts | 103 | 80 | 77.7 |
15N chemical shifts | 22 | 21 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 44 | 95.7 |
13C chemical shifts | 46 | 23 | 50.0 |
15N chemical shifts | 21 | 20 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 91 | 83 | 91.2 |
13C chemical shifts | 57 | 57 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 11 | 11 | 100.0 |
13C chemical shifts | 11 | 11 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 9 | 9 | 100.0 |
13C chemical shifts | 9 | 9 | 100.0 |
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
318 | ARG | HH11 | 6.708 |
318 | ARG | HH12 | 6.708 |
318 | ARG | HH21 | 7.132 |
318 | ARG | HH22 | 7.132 |
318 | ARG | NH2 | 71.94 |
318 | ARG | NH1 | 71.231 |
324 | ARG | HH12 | 9.008 |
324 | ARG | HH11 | 7.867 |
324 | ARG | HH22 | 9.804 |
324 | ARG | HH21 | 6.549 |
324 | ARG | NH2 | 74.573 |
324 | ARG | NH1 | 73.715 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 207 | 195 | 94.2 |
13C chemical shifts | 149 | 113 | 75.8 |
15N chemical shifts | 37 | 33 | 89.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 65 | 97.0 |
13C chemical shifts | 66 | 33 | 50.0 |
15N chemical shifts | 30 | 27 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 140 | 130 | 92.9 |
13C chemical shifts | 83 | 80 | 96.4 |
15N chemical shifts | 7 | 6 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 7 | 7 | 100.0 |
13C chemical shifts | 7 | 7 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 25 | 89.3 |
13C chemical shifts | 26 | 24 | 92.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE || | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....NE.K.NAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE -------110-------- AVKEELDRDIVSKNNAEK ||||||||||||| || AVKEELDRDIVSK...EK
200-----210-------220-- GSKSQYIDIMPDFSPSGLLELES ||||||||||||||||||||| ..KSQYIDIMPDFSPSGLLELES
300-----310-------320-------330-- GSYDKPAPENRFAIMPGSRWDGVHRSNGFEEKW ||||||||||||||||||||||||||||||| ..YDKPAPENRFAIMPGSRWDGVHRSNGFEEKW
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE ||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMGNEYKDNAYIYIG.LNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------- AVKEELDRDIVSKNNAEK ||||||||||| AVKEELDRDIV -------110-
200-----210-------220-- GSKSQYIDIMPDFSPSGLLELES ||||||| |||||||| .SKSQYID......PSGLLELE 200-----210-------220-
300-----310-------320-------330-- GSYDKPAPENRFAIMPGSRWDGVHRSNGFEEKW ||||||| |||||| ||||||||||| .SYDKPAP..RFAIMP.....GVHRSNGFEEK 300-----310-------320-------330-