Solution structure of a ribosomal protein
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.4 % (926 of 971) | 95.5 % (487 of 510) | 94.7 % (360 of 380) | 97.5 % (79 of 81) |
Backbone | 98.3 % (450 of 458) | 98.1 % (151 of 154) | 98.7 % (226 of 229) | 97.3 % (73 of 75) |
Sidechain | 93.5 % (550 of 588) | 94.4 % (336 of 356) | 92.0 % (208 of 226) | 100.0 % (6 of 6) |
Aromatic | 65.5 % (55 of 84) | 66.7 % (28 of 42) | 64.3 % (27 of 42) | |
Methyl | 100.0 % (90 of 90) | 100.0 % (45 of 45) | 100.0 % (45 of 45) |
1. rib prot
MLKHGKYVYI DLNNGKYVKV RILKSRDDNS VEKYVLTSHV SKNRPKNAIV IKMDNLPIEV KDKLTRFFLL EHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rib_prot | [U-13C; U-15N] | 0.5 ~ 1.0 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | DSS | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | [U-100% 2H] | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19860_2mmp.nef |
Input source #2: Coordindates | 2mmp.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70------- MLKHGKYVYIDLNNGKYVKVRILKSRDDNSVEKYVLTSHVSKNRPKNAIVIKMDNLPIEVKDKLTRFFLLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLKHGKYVYIDLNNGKYVKVRILKSRDDNSVEKYVLTSHVSKNRPKNAIVIKMDNLPIEVKDKLTRFFLLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 77 | 0 | 0 | 100.0 |
Content subtype: combined_19860_2mmp.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------- MLKHGKYVYIDLNNGKYVKVRILKSRDDNSVEKYVLTSHVSKNRPKNAIVIKMDNLPIEVKDKLTRFFLLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .LKHGKYVYIDLNNGKYVKVRILKSRDDNSVEKYVLTSHVSKNRPKNAIVIKMDNLPIEVKDKLTRFFLLEHHHHHH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 510 | 487 | 95.5 |
13C chemical shifts | 380 | 360 | 94.7 |
15N chemical shifts | 85 | 83 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 154 | 151 | 98.1 |
13C chemical shifts | 154 | 152 | 98.7 |
15N chemical shifts | 75 | 73 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 356 | 336 | 94.4 |
13C chemical shifts | 226 | 208 | 92.0 |
15N chemical shifts | 10 | 10 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 46 | 97.9 |
13C chemical shifts | 47 | 46 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 28 | 66.7 |
13C chemical shifts | 42 | 27 | 64.3 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70------- MLKHGKYVYIDLNNGKYVKVRILKSRDDNSVEKYVLTSHVSKNRPKNAIVIKMDNLPIEVKDKLTRFFLLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .LKHGKYVYIDLNNGKYVKVRILKSRDDNSVEKYVLTSHVSKNRPKNAIVIKMDNLPIEVKDKLTRFFLLEHHHHHH
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70------- MLKHGKYVYIDLNNGKYVKVRILKSRDDNSVEKYVLTSHVSKNRPKNAIVIKMDNLPIEVKDKLTRFFLLEHHHHHH ||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| ....GKYVYIDLNNGKYVKVRILKSRDDN..EKYVLTSHVSKNRPKNAIVIKMDNLPIEVKDKLTRFFLL --------10--------20--------30--------40--------50--------60--------70