BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	46.3 % (311 of 672)	46.1 % (158 of 343)	39.9 % (110 of 276)	81.1 % (43 of 53)
Backbone	70.5 % (227 of 322)	83.0 % (88 of 106)	58.2 % (96 of 165)	84.3 % (43 of 51)
Sidechain	32.1 % (130 of 405)	29.5 % (70 of 237)	36.1 % (60 of 166)	0.0 % (0 of 2)
Aromatic	10.0 % (4 of 40)	10.0 % (2 of 20)	10.5 % (2 of 19)	0.0 % (0 of 1)
Methyl	30.2 % (32 of 106)	43.4 % (23 of 53)	17.0 % (9 of 53)

1. human EpoR

MSEPVSLLTP SDLDPLILTL SLILVVILVL LTVLALLSHR RALKQKIWPH HHHHH

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5, Details 20 mM sodium phosphate, pH6.5, 200 mM DPC.

#	Name	Isotope labeling	Concentration
1	human EpoR	[U-100% 15N]	0.5 mM
2	sodium phosphate	natural abundance	20 mM
3	DPC	natural abundance	200 mM
4	H20	natural abundance	90 %
5	D20	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Concentration
6	human EpoR	[U-100% 13C; U-100% 15N]	0.2 ~ 0.8 mM
7	sodium phosphate	natural abundance	20 mM
8	DPC	natural abundance	200 mM
9	H20	natural abundance	90 %
10	D20	natural abundance	10 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Concentration
11	human EpoR	[U-100% 13C; U-100% 15N; U-80% 2H]	0.5 mM
12	sodium phosphate	natural abundance	20 mM
13	DPC	natural abundance	200 mM
14	H20	natural abundance	90 %
15	D20	natural abundance	10 %

Protein Blocks Logo

Calculated from 20 models in PDB: 2MV6, Strand ID: A Detail

Release date

2014-12-07

Citation

Structural insight into the transmembrane domain and the juxtamembrane region of the erythropoietin receptor in micelles
Li, Q., Wong, Y., Huang, Q., kang, C.
Biophys. J. (2014), 107, 2325-2336, PubMed 25418301 , DOI 10.1016/j.bpj.2014.10.013 , Abstract

Related entities 1. human EpoR, : 1 : 2 : 11 entities Detail

Interaction partners 1. human EpoR, : 6 interactors Detail

More details for 6 interactors identified by 5 citations

Experiments performed 9 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Concentration
11	human EpoR	[U-100% 13C; U-100% 15N; U-80% 2H]	0.5 mM
12	sodium phosphate	natural abundance	20 mM
13	DPC	natural abundance	200 mM
14	H20	natural abundance	90 %
15	D20	natural abundance	10 %

2 2D 1H-15N HSQC

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5, Details 20 mM sodium phosphate, pH6.5, 200 mM DPC.

#	Name	Isotope labeling	Concentration
1	human EpoR	[U-100% 15N]	0.5 mM
2	sodium phosphate	natural abundance	20 mM
3	DPC	natural abundance	200 mM
4	H20	natural abundance	90 %
5	D20	natural abundance	10 %

3 3D HNCA

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Concentration
6	human EpoR	[U-100% 13C; U-100% 15N]	0.2 ~ 0.8 mM
7	sodium phosphate	natural abundance	20 mM
8	DPC	natural abundance	200 mM
9	H20	natural abundance	90 %
10	D20	natural abundance	10 %

4 3D HNCACB

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Concentration
6	human EpoR	[U-100% 13C; U-100% 15N]	0.2 ~ 0.8 mM
7	sodium phosphate	natural abundance	20 mM
8	DPC	natural abundance	200 mM
9	H20	natural abundance	90 %
10	D20	natural abundance	10 %

5 3D HBHA(CO)NH

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Concentration
6	human EpoR	[U-100% 13C; U-100% 15N]	0.2 ~ 0.8 mM
7	sodium phosphate	natural abundance	20 mM
8	DPC	natural abundance	200 mM
9	H20	natural abundance	90 %
10	D20	natural abundance	10 %

6 3D HCACO

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Concentration
6	human EpoR	[U-100% 13C; U-100% 15N]	0.2 ~ 0.8 mM
7	sodium phosphate	natural abundance	20 mM
8	DPC	natural abundance	200 mM
9	H20	natural abundance	90 %
10	D20	natural abundance	10 %

7 3D HNCO

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Concentration
6	human EpoR	[U-100% 13C; U-100% 15N]	0.2 ~ 0.8 mM
7	sodium phosphate	natural abundance	20 mM
8	DPC	natural abundance	200 mM
9	H20	natural abundance	90 %
10	D20	natural abundance	10 %

8 3D 1H-15N NOESY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Concentration
6	human EpoR	[U-100% 13C; U-100% 15N]	0.2 ~ 0.8 mM
7	sodium phosphate	natural abundance	20 mM
8	DPC	natural abundance	200 mM
9	H20	natural abundance	90 %
10	D20	natural abundance	10 %

9 3D 1H-15N NOESY

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Concentration
11	human EpoR	[U-100% 13C; U-100% 15N; U-80% 2H]	0.5 mM
12	sodium phosphate	natural abundance	20 mM
13	DPC	natural abundance	200 mM
14	H20	natural abundance	90 %
15	D20	natural abundance	10 %

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_25079_2mv6.nef
Input source #2: Coordindates	2mv6.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40---------
MSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWP
|||||||||||||||||||||||||||||||||||||||||||||||||
MSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWP

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	49	0	0	100.0

Content subtype: combined_25079_2mv6.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	OK	272		93.9 (chain: A, length: 49)
1	Distance restraints	CNS/XPLOR_distance_constraints_4	Warning	260 (1)	noe	91.8 (chain: A, length: 49)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_2	OK	80 (80)	.	85.7 (chain: A, length: 49)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: OK
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 49, Sequence coverage: 93.9%
- Total number of assignments
  - ¹³C chemical shifts: 90
  - ¹H chemical shifts: 140
  - ¹⁵N chemical shifts: 42
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	246	90	36.6
¹H chemical shifts	307	130	42.3
¹⁵N chemical shifts	49	42	85.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	98	45	45.9
¹H chemical shifts	94	84	89.4
¹⁵N chemical shifts	45	42	93.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	148	45	30.4
¹H chemical shifts	213	46	21.6
¹⁵N chemical shifts	4	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	54	2	3.7
¹H chemical shifts	54	20	37.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	7	0	0.0
¹H chemical shifts	8	0	0.0
¹⁵N chemical shifts	1	0	0.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_4
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 49, Sequence coverage: 91.8%
- Total number of restraints: 260
- Weight of restraints: 1.0 (260)
- Potential type of restraints: square-well-parabolic (260)
- Range of distance target values: 3.4, 3.62 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_2
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 49, Sequence coverage: 85.7%
- Total number of restraints: 80
- Total number of restraints per polymer type: 80
- Weight of restraints: 1.0 (80)
- Potential type of restraints: square-well-parabolic (80)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords NMR assignment, membrane protein, Erythropoietin receptor

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.86 seconds)

BMRB: 25079

Sample #1

Sample #2

Sample #3

Related entities 1. human EpoR, : 1 : 2 : 11 entities Detail

Interaction partners 1. human EpoR, : 6 interactors Detail

Experiments performed 9 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail