Solution structure and 1H, 13C, and 15N chemical shift assignments for Bud31p
GGSPRIKTRR SKPAPDGFEK IKPTLTDFEI QLRDAQKDKS SKLAAKSNEQ LWEIMQLHHQ RSRYIYTLYY KRKAISKDLY DWLIKEKYAD KLLIAKWRKT GYEKLCCLRC IQKNETNNGS TCICRVPRAQ LEEEARKKGT QVSFHQCVHC GCRGCASTD
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | metal coordination | sing | 1:CYS106:SG | 2:ZN1:ZN |
2 | metal coordination | sing | 1:CYS107:SG | 2:ZN1:ZN |
3 | metal coordination | sing | 1:CYS110:SG | 2:ZN1:ZN |
4 | metal coordination | sing | 1:CYS150:SG | 2:ZN1:ZN |
5 | metal coordination | sing | 1:CYS110:SG | 2:ZN1:ZN |
6 | metal coordination | sing | 1:CYS122:SG | 2:ZN1:ZN |
7 | metal coordination | sing | 1:CYS124:SG | 2:ZN1:ZN |
8 | metal coordination | sing | 1:CYS150:SG | 2:ZN1:ZN |
9 | metal coordination | sing | 1:CYS106:SG | 2:ZN1:ZN |
10 | metal coordination | sing | 1:CYS124:SG | 2:ZN1:ZN |
11 | metal coordination | sing | 1:CYS152:SG | 2:ZN1:ZN |
12 | metal coordination | sing | 1:CYS155:SG | 2:ZN1:ZN |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 82.7 % (1597 of 1932) | 86.8 % (891 of 1026) | 73.1 % (538 of 736) | 98.8 % (168 of 170) |
Backbone | 84.1 % (794 of 944) | 98.1 % (315 of 321) | 69.7 % (327 of 469) | 98.7 % (152 of 154) |
Sidechain | 83.6 % (952 of 1139) | 81.7 % (576 of 705) | 86.1 % (360 of 418) | 100.0 % (16 of 16) |
Aromatic | 100.0 % (138 of 138) | 100.0 % (69 of 69) | 100.0 % (66 of 66) | 100.0 % (3 of 3) |
Methyl | 100.0 % (142 of 142) | 100.0 % (71 of 71) | 100.0 % (71 of 71) |
1. Bud31p polypeptide
GGSPRIKTRR SKPAPDGFEK IKPTLTDFEI QLRDAQKDKS SKLAAKSNEQ LWEIMQLHHQ RSRYIYTLYY KRKAISKDLY DWLIKEKYAD KLLIAKWRKT GYEKLCCLRC IQKNETNNGS TCICRVPRAQ LEEEARKKGT QVSFHQCVHC GCRGCASTDSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | [U-2H] | 1 mM | |
11 | D2O | natural abundance | 100 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | Bud31p (Zn)3 | [U-98% 15N] | 0.3 ~ 0.5 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium chloride | natural abundance | 150 mM | |
15 | DTT | [U-2H] | 1 mM | |
16 | D2O | natural abundance | 5 % | |
17 | H2O | natural abundance | 95 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | Bud31p (Zn)3 | [U-98% 15N] | 0.3 ~ 0.5 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium chloride | natural abundance | 150 mM | |
15 | DTT | [U-2H] | 1 mM | |
16 | D2O | natural abundance | 5 % | |
17 | H2O | natural abundance | 95 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | [U-2H] | 1 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance AVI - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Bud31p (Zn)3 | [U-98% 13C; U-98% 15N] | 0.3 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | [U-2H] | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25439_2my1.nef |
Input source #2: Coordindates | 2my1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:122:CYS:SG | 2:3:ZN:ZN | unknown | unknown | n/a |
1:150:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:106:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:155:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:124:CYS:SG | 2:3:ZN:ZN | unknown | unknown | n/a |
1:110:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:110:CYS:SG | 2:3:ZN:ZN | unknown | unknown | n/a |
1:152:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:107:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:147:CYS:SG | 2:3:ZN:ZN | unknown | unknown | n/a |
1:106:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:124:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
B | 2 | ZN | ZINC ION | None |
B | 3 | ZN | ZINC ION | None |
Sequence alignments
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GGSPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWEIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GGSPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWEIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 00-------110-------120-------130-------140-------150------- GYEKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCRGCASTD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GYEKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCRGCASTD -------110-------120-------130-------140-------150---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 159 | 0 | 0 | 100.0 |
Content subtype: combined_25439_2my1.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GGSPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWEIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GGSPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWEIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKT 00-------110-------120-------130-------140-------150------- GYEKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCRGCASTD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GYEKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCRGCASTD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1026 | 878 | 85.6 |
13C chemical shifts | 736 | 509 | 69.2 |
15N chemical shifts | 183 | 167 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 321 | 317 | 98.8 |
13C chemical shifts | 318 | 158 | 49.7 |
15N chemical shifts | 154 | 151 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 705 | 561 | 79.6 |
13C chemical shifts | 418 | 351 | 84.0 |
15N chemical shifts | 29 | 16 | 55.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 72 | 100.0 |
13C chemical shifts | 72 | 72 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 69 | 100.0 |
13C chemical shifts | 66 | 66 | 100.0 |
15N chemical shifts | 3 | 3 | 100.0 |
Covalent bonds
Distance restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GGSPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWEIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKT ||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...PRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKS.KLAAKSNEQLWEIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKT 00-------110-------120-------130-------140-------150------- GYEKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCRGCASTD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GYEKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCRGCASTD
Dihedral angle restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GGSPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWEIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKT ||||| ||||||||||||||||| ||||||||||||||||||||||||| ||||||||||||||||||||||| ................GFEKI..TLTDFEIQLRDAQKDKS......SNEQLWEIMQLHHQRSRYIYTLYYK....SKDLYDWLIKEKYADKLLIAKWR.. -0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 00-------110-------120-------130-------140-------150------- GYEKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCRGCASTD |||||||||||| ..........................PRAQLEEEARKK 00-------110-------120-------130------