Solution structure of the BCOR PUFD
SDVFEFEFSE TPLLPSYNIQ VSVAQGPRNW LLLSDVLKKL KMSSRIFRSN FPNVEIVTIA EAEFYRQVSA SLLFSSSKDL EAFNPESKEL LDLVEFTNEI QTLLGSSVEW LHPSD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.8 % (1116 of 1382) | 78.7 % (563 of 715) | 81.9 % (447 of 546) | 87.6 % (106 of 121) |
Backbone | 91.4 % (620 of 678) | 91.2 % (206 of 226) | 91.5 % (314 of 343) | 91.7 % (100 of 109) |
Sidechain | 73.4 % (600 of 817) | 73.0 % (357 of 489) | 75.0 % (237 of 316) | 50.0 % (6 of 12) |
Aromatic | 16.4 % (22 of 134) | 25.4 % (17 of 67) | 7.7 % (5 of 65) | 0.0 % (0 of 2) |
Methyl | 96.4 % (133 of 138) | 95.7 % (66 of 69) | 97.1 % (67 of 69) |
1. BCOR PUFD
SDVFEFEFSE TPLLPSYNIQ VSVAQGPRNW LLLSDVLKKL KMSSRIFRSN FPNVEIVTIA EAEFYRQVSA SLLFSSSKDL EAFNPESKEL LDLVEFTNEI QTLLGSSVEW LHPSDSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 3 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | na | indirect | 1.0 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 3 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 3 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 3 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 3 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 3 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 3 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 3 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 3 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_25565_2n1l.nef |
Input source #2: Coordindates | 2n1l.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----10--------20--------30--------40--------50--------60--------70--------80--------90-------100--- SDVFEFEFSETPLLPSYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNVEIVTIAEAEFYRQVSASLLFSSSKDLEAFNPESKELLDLVEFTNEI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDVFEFEFSETPLLPSYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNVEIVTIAEAEFYRQVSASLLFSSSKDLEAFNPESKELLDLVEFTNEI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ----110-------- QTLLGSSVEWLHPSD ||||||||||||||| QTLLGSSVEWLHPSD -------110-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 115 | 0 | 0 | 100.0 |
Content subtype: combined_25565_2n1l.nef
Assigned chemical shifts
-----10--------20--------30--------40--------50--------60--------70--------80--------90-------100--- SDVFEFEFSETPLLPSYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNVEIVTIAEAEFYRQVSASLLFSSSKDLEAFNPESKELLDLVEFTNEI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||| || SDVFEFEFSETPLLPSYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNVEIVTIAEAEFYRQVSASLLF...KDLEAFNPESKELLDLVEFT.EI ----110-------- QTLLGSSVEWLHPSD |||||| |||||||| QTLLGS.VEWLHPSD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 715 | 558 | 78.0 |
13C chemical shifts | 546 | 446 | 81.7 |
15N chemical shifts | 125 | 102 | 81.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 226 | 206 | 91.2 |
13C chemical shifts | 230 | 210 | 91.3 |
15N chemical shifts | 109 | 96 | 88.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 489 | 352 | 72.0 |
13C chemical shifts | 316 | 236 | 74.7 |
15N chemical shifts | 16 | 6 | 37.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 66 | 94.3 |
13C chemical shifts | 70 | 67 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 12 | 17.9 |
13C chemical shifts | 65 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
-----10--------20--------30--------40--------50--------60--------70--------80--------90-------100--- SDVFEFEFSETPLLPSYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNVEIVTIAEAEFYRQVSASLLFSSSKDLEAFNPESKELLDLVEFTNEI ||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||| |||||||||||||||||||| || SDVFEFEFSETPLLPSYNIQVSVAQGPRNWLLLSDVLKKLKMS.RIFRSNFPNVEIVTIAEAEFYRQVSASLLF...KDLEAFNPESKELLDLVEFT.EI ----110-------- QTLLGSSVEWLHPSD |||||| |||| ||| QTLLGS.VEWL.PSD
Dihedral angle restraints
-----10--------20--------30--------40--------50--------60--------70--------80--------90-------100--- SDVFEFEFSETPLLPSYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNVEIVTIAEAEFYRQVSASLLFSSSKDLEAFNPESKELLDLVEFTNEI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||| ..VFEFEFSETPLLPSYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNVEIVTIAEAEFYRQVSASLLF..SKDLEAFNPESKELLDLVEFTNEI ----110-------- QTLLGSSVEWLHPSD ||||||||||||||| QTLLGSSVEWLHPSD
RDC restraints
-----10--------20--------30--------40--------50--------60--------70--------80--------90-------100--- SDVFEFEFSETPLLPSYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNVEIVTIAEAEFYRQVSASLLFSSSKDLEAFNPESKELLDLVEFTNEI ||||||| | || ||||||| || |||||||||||||||| |||||| |||||||||||||||||||||| |||||| || ||||||||| | .DVFEFEF..T.LL.SYNIQVS..QG.RNWLLLSDVLKKLKMS..IFRSNF.NVEIVTIAEAEFYRQVSASLLF....DLEAFN.ES.ELLDLVEFT..I ----110-------- QTLLGSSVEWLHPSD ||||| |||| | QTLLG...EWLH..D