Solution Structure of R. palustris CsgH
MVQCEVEAAV SGGHVTLQGV ITAVRDGAGS YKLAVDKAGA AGTSRIKQAG AFTAIAEQRV TVGNVVLDYS SANRYAARLD VSFGSVTIQC NLDPETVKLE HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.1 % (1016 of 1128) | 89.1 % (508 of 570) | 91.0 % (405 of 445) | 91.2 % (103 of 113) |
Backbone | 95.9 % (608 of 634) | 95.5 % (211 of 221) | 96.1 % (296 of 308) | 96.2 % (101 of 105) |
Sidechain | 84.7 % (500 of 590) | 85.1 % (297 of 349) | 86.3 % (201 of 233) | 25.0 % (2 of 8) |
Aromatic | 30.6 % (22 of 72) | 33.3 % (12 of 36) | 27.8 % (10 of 36) | |
Methyl | 100.0 % (140 of 140) | 100.0 % (70 of 70) | 100.0 % (70 of 70) |
1. CsgH
MVQCEVEAAV SGGHVTLQGV ITAVRDGAGS YKLAVDKAGA AGTSRIKQAG AFTAIAEQRV TVGNVVLDYS SANRYAARLD VSFGSVTIQC NLDPETVKLE HHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | MES | natural abundance | 10 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | MES | natural abundance | 10 mM | |
9 | D2O | [U-2H] | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | methyl carbons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.83 ppm | internal | direct | 1.0 |
15N | na | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | methyl carbons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.83 ppm | internal | direct | 1.0 |
15N | na | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | methyl carbons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.83 ppm | internal | direct | 1.0 |
15N | na | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | methyl carbons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.83 ppm | internal | direct | 1.0 |
15N | na | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | MES | natural abundance | 10 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | MES | natural abundance | 10 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | MES | natural abundance | 10 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | MES | natural abundance | 10 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | MES | natural abundance | 10 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | MES | natural abundance | 10 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | MES | natural abundance | 10 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | MES | natural abundance | 10 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | MES | natural abundance | 10 mM | |
9 | D2O | [U-2H] | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | MES | natural abundance | 10 mM | |
9 | D2O | [U-2H] | 100 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | MES | natural abundance | 10 mM | |
9 | D2O | [U-2H] | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CsgH | [U-98% 13C; U-98% 15N] | 400 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | MES | natural abundance | 10 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25700_2n59.nef |
Input source #2: Coordindates | 2n59.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:4:CYS:SG | A:90:CYS:SG | oxidized, CA 53.402, CB 45.525 ppm | oxidized, CA 54.874, CB 50.267 ppm | 2.033 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGAAGTSRIKQAGAFTAIAEQRVTVGNVVLDYSSANRYAARLDVSFGSVTIQCNLDPETVKLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGAAGTSRIKQAGAFTAIAEQRVTVGNVVLDYSSANRYAARLDVSFGSVTIQCNLDPETVKLE ------ HHHHHH |||||| HHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_25700_2n59.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGAAGTSRIKQAGAFTAIAEQRVTVGNVVLDYSSANRYAARLDVSFGSVTIQCNLDPETVKLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGAAGTSRIKQAGAFTAIAEQRVTVGNVVLDYSSANRYAARLDVSFGSVTIQCNLDPETVKLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------ HHHHHH | H -
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 445 | 399 | 89.7 |
1H chemical shifts | 570 | 492 | 86.3 |
15N chemical shifts | 118 | 99 | 83.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 212 | 200 | 94.3 |
1H chemical shifts | 221 | 208 | 94.1 |
15N chemical shifts | 105 | 99 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 233 | 199 | 85.4 |
1H chemical shifts | 349 | 284 | 81.4 |
15N chemical shifts | 13 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 71 | 70 | 98.6 |
1H chemical shifts | 71 | 70 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 36 | 10 | 27.8 |
1H chemical shifts | 36 | 10 | 27.8 |
Covalent bonds
Distance restraints
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGAAGTSRIKQAGAFTAIAEQRVTVGNVVLDYSSANRYAARLDVSFGSVTIQCNLDPETVKLE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGAAGTSRIKQAGAFTAIAEQRVTVGNVVLDYSSANRYAARLDVSFGSVTIQCNLDPETV --------10--------20--------30--------40--------50--------60--------70--------80--------90------- ------ HHHHHH