RPT1 region of INI1/SNF5/SMARCB1_HUMAN - SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.4 % (975 of 991) | 97.1 % (503 of 518) | 99.7 % (386 of 387) | 100.0 % (86 of 86) |
Backbone | 98.6 % (479 of 486) | 96.3 % (155 of 161) | 99.6 % (247 of 248) | 100.0 % (77 of 77) |
Sidechain | 98.5 % (578 of 587) | 97.5 % (348 of 357) | 100.0 % (221 of 221) | 100.0 % (9 of 9) |
Aromatic | 100.0 % (50 of 50) | 100.0 % (25 of 25) | 100.0 % (24 of 24) | 100.0 % (1 of 1) |
Methyl | 99.0 % (103 of 104) | 98.1 % (51 of 52) | 100.0 % (52 of 52) |
1. Rpt1-ini1
PEVLVPIRLD MEIDGQKLRD AFTWNMNEKL MTPEMFSEIL CDDLDLNPLT FVPAIASAIR QQIESYPTDS ILEDQSDQRV IIKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | protons | 0.0 ppm | internal | indirect | 0.1013291 |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpt1/ini1 | [U-95% 13C; U-95% 15N] | 250 uM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | TSP | natural abundance | 0.01 (±0.01) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_27243_6ax5.nef |
Input source #2: Coordindates | 6ax5.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----190-------200-------210-------220-------230-------240-------250-------260----- PEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIK --------10--------20--------30--------40--------50--------60--------70--------80---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 83 | 0 | 0 | 100.0 |
Content subtype: combined_27243_6ax5.nef
Assigned chemical shifts
-----190-------200-------210-------220-------230-------240-------250-------260----- PEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
214 | THR | HG1 | 6.106 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 518 | 514 | 99.2 |
13C chemical shifts | 387 | 387 | 100.0 |
15N chemical shifts | 90 | 86 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 161 | 161 | 100.0 |
13C chemical shifts | 166 | 166 | 100.0 |
15N chemical shifts | 77 | 77 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 357 | 353 | 98.9 |
13C chemical shifts | 221 | 221 | 100.0 |
15N chemical shifts | 13 | 9 | 69.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 56 | 100.0 |
13C chemical shifts | 56 | 56 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 25 | 25 | 100.0 |
13C chemical shifts | 24 | 24 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-----190-------200-------210-------220-------230-------240-------250-------260----- PEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIK
-----190-------200-------210-------220-------230-------240-------250-------260----- PEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIK ||||||||||| |||||||||||||||||||| ||||| ||||||||||||||||| |||| || ||||| || ..VLVPIRLDMEI..QKLRDAFTWNMNEKLMTPEM.SEILC..LDLNPLTFVPAIASAIR.QIES.PT....EDQSD...II -----190-------200-------210-------220-------230-------240-------250-------260----