BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	91.5 % (1720 of 1880)	92.4 % (907 of 982)	89.2 % (653 of 732)	96.4 % (160 of 166)
Backbone	93.8 % (900 of 960)	94.9 % (315 of 332)	92.0 % (438 of 476)	96.7 % (147 of 152)
Sidechain	90.4 % (966 of 1068)	91.1 % (592 of 650)	89.4 % (361 of 404)	92.9 % (13 of 14)
Aromatic	73.9 % (105 of 142)	87.3 % (62 of 71)	59.4 % (41 of 69)	100.0 % (2 of 2)
Methyl	97.4 % (148 of 152)	98.7 % (75 of 76)	96.1 % (73 of 76)

1. entity 1

GHMTGVESFM TKQDTTGKII SIDTSSLRAA GRTGWEDLVR KCIYAFFQPQ GREPSYARQL FQEVMTRGTA SSPSYRFILN DGTMLSAHTR CKLCYPQSPD MQPFIMGIHI IDREHSGLSP QDDTNSGMSI PR

2. entity 2

GTWIGEDIFP PLLPPTEQDL TKLLLEGQGE SG

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 1 mM [U-99% 13C; U-99% 15N] STAT6, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HEPES	natural abundance	50 mM
2	sodium chloride	natural abundance	150 mM
3	D2O	natural abundance	10 %
4	STAT6	[U-99% 13C; U-99% 15N]	1 mM

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 1 mM [U-99% 13C; U-99% 15N] STAT6, 0.7 mM NCoA1, 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 0.7 mM [U-99% 13C; U-99% 15N] NCoA1, 1 mM STAT6, 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
10	HEPES	natural abundance	50 mM
11	sodium chloride	natural abundance	150 mM
12	D2O	natural abundance	10 %
13	STAT6	natural abundance	1 mM
14	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

Sample #4

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 1 mM [U-99% 15N] STAT6, 0.7 mM NCoA1, 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
15	HEPES	natural abundance	50 mM
16	sodium chloride	natural abundance	150 mM
17	D2O	natural abundance	10 %
18	STAT6	[U-99% 15N]	1 mM
19	NCoA1	natural abundance	0.7 mM

Sample #5

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 0.7 mM [U-99% 15N] NCoA1, 1 mM STAT6, 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
20	HEPES	natural abundance	50 mM
21	sodium chloride	natural abundance	150 mM
22	D2O	natural abundance	10 %
23	STAT6	natural abundance	1 mM
24	NCoA1	[U-99% 15N]	0.7 mM

Sample #6

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 1 mM [U-99% 15N] STAT6, 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
25	HEPES	natural abundance	50 mM
26	sodium chloride	natural abundance	150 mM
27	D2O	natural abundance	10 %
28	STAT6	[U-99% 15N]	1 mM

Sample #7

Solvent system 100% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 1 mM [U-99% 13C; U-99% 15N] STAT6, 0.7 mM NCoA1, 50 mM HEPES, 150 mM sodium chloride, 100 % D2O, 100% D2O

#	Name	Isotope labeling	Concentration
29	HEPES	natural abundance	50 mM
30	sodium chloride	natural abundance	150 mM
31	D2O	natural abundance	100 %
32	STAT6	[U-99% 13C; U-99% 15N]	1 mM
33	NCoA1	natural abundance	0.7 mM

Sample #8

Solvent system 100% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 0.7 mM [U-99% 13C; U-99% 15N] NCoA1, 1 mM STAT6, 50 mM HEPES, 150 mM sodium chloride, 100 % D2O, 100% D2O

#	Name	Isotope labeling	Concentration
34	HEPES	natural abundance	50 mM
35	sodium chloride	natural abundance	150 mM
36	D2O	natural abundance	100 %
37	STAT6	natural abundance	1 mM
38	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

Protein Blocks Logo

Calculated from 20 models in PDB: 5NWM, Strand ID: A, B Detail

Release date

2017-11-30

Citation

Insight into the molecular recognition mechanism of the coactivator NCoA1 by STAT6
Russo, L., Giller, K., Pfitzner, E., Griesinger, C., Becker, S.
Sci. Rep. (2017), 7, 16845-16845, PubMed 29203888 , DOI 10.1038/s41598-017-17088-5 , Abstract

Related entities 1. Nuclear receptor coactivator 1 (E.C.2.3.1.48), Signal transducer and activator of transcription 6, entity 1, : 26 entities Detail

Related entities 2. Nuclear receptor coactivator 1 (E.C.2.3.1.48), Signal transducer and activator of transcription 6, entity 2, : 1 : 3 : 5 entities Detail

Interaction partners 1. Nuclear receptor coactivator 1 (E.C.2.3.1.48), Signal transducer and activator of transcription 6, entity 1, : 25 interactors Detail

More details for 25 interactors identified by 17 citations

Interaction partners 2. Nuclear receptor coactivator 1 (E.C.2.3.1.48), Signal transducer and activator of transcription 6, entity 2, : 35 interactors Detail

More details for 35 interactors identified by 9 citations

Experiments performed 36 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker AvanceIII - 600 MHz room temperature probe

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 1 mM [U-99% 13C; U-99% 15N] STAT6, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HEPES	natural abundance	50 mM
2	sodium chloride	natural abundance	150 mM
3	D2O	natural abundance	10 %
4	STAT6	[U-99% 13C; U-99% 15N]	1 mM

2 2D 1H-13C HSQC aliphatic

Instrument

Bruker AvanceIII - 600 MHz room temperature probe

Sample

#	Name	Isotope labeling	Concentration
1	HEPES	natural abundance	50 mM
2	sodium chloride	natural abundance	150 mM
3	D2O	natural abundance	10 %
4	STAT6	[U-99% 13C; U-99% 15N]	1 mM

3 3D CBCA(CO)NH

Instrument

Bruker AvanceIII - 600 MHz room temperature probe

Sample

#	Name	Isotope labeling	Concentration
1	HEPES	natural abundance	50 mM
2	sodium chloride	natural abundance	150 mM
3	D2O	natural abundance	10 %
4	STAT6	[U-99% 13C; U-99% 15N]	1 mM

4 3D HNCA

Instrument

Bruker AvanceIII - 600 MHz room temperature probe

Sample

#	Name	Isotope labeling	Concentration
1	HEPES	natural abundance	50 mM
2	sodium chloride	natural abundance	150 mM
3	D2O	natural abundance	10 %
4	STAT6	[U-99% 13C; U-99% 15N]	1 mM

5 3D 1H-15N TOCSY

Instrument

Bruker AvanceIII - 600 MHz room temperature probe

Sample

#	Name	Isotope labeling	Concentration
1	HEPES	natural abundance	50 mM
2	sodium chloride	natural abundance	150 mM
3	D2O	natural abundance	10 %
4	STAT6	[U-99% 13C; U-99% 15N]	1 mM

6 3D 1H-15N NOESY

Instrument

Bruker AvanceIII - 700 MHz room temperature probe

Sample

#	Name	Isotope labeling	Concentration
1	HEPES	natural abundance	50 mM
2	sodium chloride	natural abundance	150 mM
3	D2O	natural abundance	10 %
4	STAT6	[U-99% 13C; U-99% 15N]	1 mM

7 2D 1H-15N HSQC

Instrument

Bruker AvanceIII - 600 MHz room temperature probe

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 1 mM [U-99% 13C; U-99% 15N] STAT6, 0.7 mM NCoA1, 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

8 2D 1H-13C HSQC aliphatic

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

9 2D 1H-13C HSQC aromatic

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

10 3D CBCA(CO)NH

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

11 3D HNCO

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

12 3D HNCA

Instrument

Bruker AvanceIII - 700 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

13 3D 1H-15N NOESY

Instrument

Bruker AvanceIII - 800 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

14 3D 1H-15N TOCSY

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

15 3D 1H-15N TOCSY

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 0.7 mM [U-99% 13C; U-99% 15N] NCoA1, 1 mM STAT6, 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
10	HEPES	natural abundance	50 mM
11	sodium chloride	natural abundance	150 mM
12	D2O	natural abundance	10 %
13	STAT6	natural abundance	1 mM
14	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

16 3D 1H-15N NOESY

Instrument

Bruker AvanceIII - 800 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
10	HEPES	natural abundance	50 mM
11	sodium chloride	natural abundance	150 mM
12	D2O	natural abundance	10 %
13	STAT6	natural abundance	1 mM
14	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

17 2D 1H-15N HSQC

Instrument

Bruker AvanceIII - 600 MHz room temperature probe

Sample

#	Name	Isotope labeling	Concentration
10	HEPES	natural abundance	50 mM
11	sodium chloride	natural abundance	150 mM
12	D2O	natural abundance	10 %
13	STAT6	natural abundance	1 mM
14	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

18 3D HNCACB

Instrument

Bruker AvanceIII - 700 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

19 3D HCCH-TOCSY

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 1 mM [U-99% 13C; U-99% 15N] STAT6, 0.7 mM NCoA1, 50 mM HEPES, 150 mM sodium chloride, 100 % D2O, 100% D2O

#	Name	Isotope labeling	Concentration
29	HEPES	natural abundance	50 mM
30	sodium chloride	natural abundance	150 mM
31	D2O	natural abundance	100 %
32	STAT6	[U-99% 13C; U-99% 15N]	1 mM
33	NCoA1	natural abundance	0.7 mM

20 3D HNHA

Instrument

Bruker AvanceIII - 700 MHz room temperature probe

Sample

#	Name	Isotope labeling	Concentration
1	HEPES	natural abundance	50 mM
2	sodium chloride	natural abundance	150 mM
3	D2O	natural abundance	10 %
4	STAT6	[U-99% 13C; U-99% 15N]	1 mM

21 3D HNHA

Instrument

Bruker AvanceIII - 700 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
5	HEPES	natural abundance	50 mM
6	sodium chloride	natural abundance	150 mM
7	D2O	natural abundance	10 %
8	STAT6	[U-99% 13C; U-99% 15N]	1 mM
9	NCoA1	natural abundance	0.7 mM

22 3D 1H-13C NOESY aromatic

Instrument

Bruker AvanceIII - 800 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
29	HEPES	natural abundance	50 mM
30	sodium chloride	natural abundance	150 mM
31	D2O	natural abundance	100 %
32	STAT6	[U-99% 13C; U-99% 15N]	1 mM
33	NCoA1	natural abundance	0.7 mM

23 3D 1H-13C NOESY aliphatic

Instrument

Bruker AvanceIII - 800 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
29	HEPES	natural abundance	50 mM
30	sodium chloride	natural abundance	150 mM
31	D2O	natural abundance	100 %
32	STAT6	[U-99% 13C; U-99% 15N]	1 mM
33	NCoA1	natural abundance	0.7 mM

24 3D HNCA

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
10	HEPES	natural abundance	50 mM
11	sodium chloride	natural abundance	150 mM
12	D2O	natural abundance	10 %
13	STAT6	natural abundance	1 mM
14	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

25 3D HNCO

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
10	HEPES	natural abundance	50 mM
11	sodium chloride	natural abundance	150 mM
12	D2O	natural abundance	10 %
13	STAT6	natural abundance	1 mM
14	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

26 3D CBCA(CO)NH

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
10	HEPES	natural abundance	50 mM
11	sodium chloride	natural abundance	150 mM
12	D2O	natural abundance	10 %
13	STAT6	natural abundance	1 mM
14	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

27 2D 1H-13C HSQC aromatic

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
10	HEPES	natural abundance	50 mM
11	sodium chloride	natural abundance	150 mM
12	D2O	natural abundance	10 %
13	STAT6	natural abundance	1 mM
14	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

28 2D 1H-13C HSQC aliphatic

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
10	HEPES	natural abundance	50 mM
11	sodium chloride	natural abundance	150 mM
12	D2O	natural abundance	10 %
13	STAT6	natural abundance	1 mM
14	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

29 3D HCCH-TOCSY

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 0.7 mM [U-99% 13C; U-99% 15N] NCoA1, 1 mM STAT6, 50 mM HEPES, 150 mM sodium chloride, 100 % D2O, 100% D2O

#	Name	Isotope labeling	Concentration
34	HEPES	natural abundance	50 mM
35	sodium chloride	natural abundance	150 mM
36	D2O	natural abundance	100 %
37	STAT6	natural abundance	1 mM
38	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

30 3D HNHA

Instrument

Bruker AvanceIII - 600 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
10	HEPES	natural abundance	50 mM
11	sodium chloride	natural abundance	150 mM
12	D2O	natural abundance	10 %
13	STAT6	natural abundance	1 mM
14	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

31 3D 1H-13C NOESY aromatic

Instrument

Bruker AvanceIII - 800 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
34	HEPES	natural abundance	50 mM
35	sodium chloride	natural abundance	150 mM
36	D2O	natural abundance	100 %
37	STAT6	natural abundance	1 mM
38	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

32 3D 1H-13C NOESY aliphatic

Instrument

Bruker AvanceIII - 800 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
34	HEPES	natural abundance	50 mM
35	sodium chloride	natural abundance	150 mM
36	D2O	natural abundance	100 %
37	STAT6	natural abundance	1 mM
38	NCoA1	[U-99% 13C; U-99% 15N]	0.7 mM

33 2D 1H-15N HSQC

Instrument

Bruker AvanceIII - 900 MHz cryoprobe

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 0.7 mM [U-99% 15N] NCoA1, 1 mM STAT6, 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
20	HEPES	natural abundance	50 mM
21	sodium chloride	natural abundance	150 mM
22	D2O	natural abundance	10 %
23	STAT6	natural abundance	1 mM
24	NCoA1	[U-99% 15N]	0.7 mM

34 2D 1H-15N HSQC

Instrument

Bruker AvanceIII - 900 MHz cryoprobe

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 1 mM [U-99% 15N] STAT6, 0.7 mM NCoA1, 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
15	HEPES	natural abundance	50 mM
16	sodium chloride	natural abundance	150 mM
17	D2O	natural abundance	10 %
18	STAT6	[U-99% 15N]	1 mM
19	NCoA1	natural abundance	0.7 mM

35 2D 1H-15N HSQC

Instrument

Bruker AvanceIII - 900 MHz cryoprobe

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 309 K, pH 7.0, Details 1 mM [U-99% 15N] STAT6, 50 mM HEPES, 150 mM sodium chloride, 10 % D2O, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
25	HEPES	natural abundance	50 mM
26	sodium chloride	natural abundance	150 mM
27	D2O	natural abundance	10 %
28	STAT6	[U-99% 15N]	1 mM

36 3D 1H,13C-edited/12C-filter NOESY

Instrument

Bruker AvanceIII - 700 MHz cryoprobe

Sample

#	Name	Isotope labeling	Concentration
29	HEPES	natural abundance	50 mM
30	sodium chloride	natural abundance	150 mM
31	D2O	natural abundance	100 %
32	STAT6	[U-99% 13C; U-99% 15N]	1 mM
33	NCoA1	natural abundance	0.7 mM

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints	combined_34131_5nwm.nef
Input source #2: Coordindates	5nwm.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

----260-------270-------280-------290-------300-------310-------320-------330-------340-------350---
GHMTGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPQSPD
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GHMTGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPQSPD
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100

----360-------370-------380-----
MQPFIMGIHIIDREHSGLSPQDDTNSGMSIPR
||||||||||||||||||||||||||||||||
MQPFIMGIHIIDREHSGLSPQDDTNSGMSIPR
-------110-------120-------130--

Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

-----790-------800-------810----
GTWIGEDIFPPLLPPTEQDLTKLLLEGQGESG
||||||||||||||||||||||||||||||||
GTWIGEDIFPPLLPPTEQDLTKLLLEGQGESG
--------10--------20--------30--

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	132	0	0	100.0
B	B	32	0	0	100.0

Content subtype: combined_34131_5nwm.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chemical_shifts_1	Warning	1731		95.5 (chain: A, length: 132), 96.9 (chain: B, length: 32)
1	Distance restraints	DYANA/DIANA_distance_constraints_3	OK	1505 (1)	noe	91.7 (chain: A, length: 132), 93.8 (chain: B, length: 32)
2	Distance restraints	DYANA/DIANA_distance_constraints_4	OK	80 (1)	hbond	40.9 (chain: A, length: 132)

Assigned chemical shifts

Saveframe: assigned_chemical_shifts_1

Status: Warning

Sequence coverage of experimental data

Entity_assembly_ID: A, Chain length: 132, Sequence coverage: 95.5%

----260-------270-------280-------290-------300-------310-------320-------330-------340-------350---
GHMTGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPQSPD
   ||||||||||||||||||||||||||||||||||||||||||||||||  |||||||||||||||||||||||||||||||||||||||||||||||
...TGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQG..PSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPQSPD

----360-------370-------380-----
MQPFIMGIHIIDREHSGLSPQDDTNSGMSIPR
||||||||||||||||||| ||||||||||||
MQPFIMGIHIIDREHSGLS.QDDTNSGMSIPR

Entity_assembly_ID: B, Chain length: 32, Sequence coverage: 96.9%

-----790-------800-------810----
GTWIGEDIFPPLLPPTEQDLTKLLLEGQGESG
 |||||||||||||||||||||||||||||||
.TWIGEDIFPPLLPPTEQDLTKLLLEGQGESG

Total number of assignments
- ¹H chemical shifts: 922
- ¹³C chemical shifts: 645
- ¹⁵N chemical shifts: 164

Completeness of assignments

Entity_assemble_ID: A

Excluded Atom_ID in statistics

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
264	THR	HG1	-1.601
269	THR	HG1	-1.636
286	THR	HG1	-1.428
295	CYS	HG	-1.726
319	THR	HG1	-1.783
341	HIS	ND1	214.022
341	HIS	NE2	180.59
344	CYS	HG	-1.606
347	CYS	HG	-1.83
362	HIS	ND1	222.742
362	HIS	NE2	179.607
368	HIS	ND1	226.922
368	HIS	NE2	177.73
377	THR	HG1	-1.712

All atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	790	726	91.9
¹³C chemical shifts	587	509	86.7
¹⁵N chemical shifts	145	128	88.3

Backbone atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	267	254	95.1
¹³C chemical shifts	264	233	88.3
¹⁵N chemical shifts	124	118	95.2

Side chain atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	523	472	90.2
¹³C chemical shifts	323	276	85.4
¹⁵N chemical shifts	21	10	47.6

Methyl group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	64	56	87.5
¹³C chemical shifts	64	55	85.9

Aromatic group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	60	52	86.7
¹³C chemical shifts	59	32	54.2
¹⁵N chemical shifts	1	1	100.0

Entity_assemble_ID: B

Redox state of CYS
Peptide bond of PRO
Tautomeric state of HIS
Rotameric state of ILE , LEU, and VAL
Histogram of normalized assigned chemical shifts
Random coil index and derived parameters (S² and NMR RMSD)
- Chain_ID: A
- Chain_ID: B

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_3
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 132, Sequence coverage: 91.7%
  - Entity_assembly_ID: B, Chain length: 32, Sequence coverage: 93.8%
- Total number of restraints: 1505
- Weight of restraints: 1.0 (1505)
- Potential type of restraints: upper-bound-parabolic (1505)
- Range of distance target values: 2.15, 11.8 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_4
  - Status: OK
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 132, Sequence coverage: 40.9%
  - Total number of restraints: 80
  - Weight of restraints: 1.0 (80)
  - Potential type of restraints: upper-bound-parabolic (80)
  - Range of distance target values: 2.0, 3.0 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
    - Chain_ID: B
      None
  - Distance restraints on contact map

Keywords LXXLL motif, NCoA-1, PAS-B domain, STAT6, signaling protein, transactivation domain

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	192	188	97.9
¹³C chemical shifts	145	136	93.8
¹⁵N chemical shifts	31	30	96.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	65	62	95.4
¹³C chemical shifts	64	57	89.1
¹⁵N chemical shifts	28	27	96.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	127	126	99.2
¹³C chemical shifts	81	79	97.5
¹⁵N chemical shifts	3	3	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	11	10	90.9
¹³C chemical shifts	10	9	90.0
¹⁵N chemical shifts	1	1	100.0

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (1.653 seconds)

BMRB: 34131

Sample #1

Sample #2

Sample #3

Sample #4

Sample #5

Sample #6

Sample #7

Sample #8

Related entities 1. Nuclear receptor coactivator 1 (E.C.2.3.1.48), Signal transducer and activator of transcription 6, entity 1, : 26 entities Detail

Related entities 2. Nuclear receptor coactivator 1 (E.C.2.3.1.48), Signal transducer and activator of transcription 6, entity 2, : 1 : 3 : 5 entities Detail

Interaction partners 1. Nuclear receptor coactivator 1 (E.C.2.3.1.48), Signal transducer and activator of transcription 6, entity 1, : 25 interactors Detail

Interaction partners 2. Nuclear receptor coactivator 1 (E.C.2.3.1.48), Signal transducer and activator of transcription 6, entity 2, : 35 interactors Detail

Experiments performed 36 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample