Structure model of a protein-DNA complex
AKAQRTHLSL EEKIKLMRLV VRHKHELVDR KTSEFYAKIA RIGYEDEGLA IHTESACRNQ IISIMRVYEQ RLAHRQPGMK TTPEEDELDQ LCDEWKARLS ELQQYREKFL V
Polymer type: polypeptide(L) polydeoxyribonucleotide
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 66.2 % (1053 of 1590) | 53.4 % (507 of 949) | 84.7 % (443 of 523) | 87.3 % (103 of 118) |
Backbone | 72.2 % (599 of 830) | 49.1 % (192 of 391) | 93.6 % (309 of 330) | 89.9 % (98 of 109) |
Sidechain | 63.9 % (555 of 868) | 56.5 % (315 of 558) | 78.1 % (235 of 301) | 55.6 % (5 of 9) |
Aromatic | 28.8 % (38 of 132) | 22.2 % (20 of 90) | 41.5 % (17 of 41) | 100.0 % (1 of 1) |
Methyl | 71.2 % (94 of 132) | 66.2 % (47 of 71) | 77.0 % (47 of 61) |
1. entity 1
AKAQRTHLSL EEKIKLMRLV VRHKHELVDR KTSEFYAKIA RIGYEDEGLA IHTESACRNQ IISIMRVYEQ RLAHRQPGMK TTPEEDELDQ LCDEWKARLS ELQQYREKFL V2. entity 2
CAAAACAATA TT3. entity 3
AATATTGTTT TGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 15N][U-99% 13C; U-99% 15N] Sap1, 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sap1 | [U-99% 15N][U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 13C; U-99% 15N] Sap1, 0.7 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.7 mM | |
4 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
5 | Sap1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.5 mM | |
8 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
9 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 15N][U-99% 13C; U-99% 15N] Sap1, 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sap1 | [U-99% 15N][U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 13C; U-99% 15N] Sap1, 0.7 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.7 mM | |
4 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
5 | Sap1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 13C; U-99% 15N] Sap1, 0.7 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.7 mM | |
4 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
5 | Sap1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.5 mM | |
8 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
9 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 13C; U-99% 15N] Sap1, 0.7 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.7 mM | |
4 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
5 | Sap1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 13C; U-99% 15N] Sap1, 0.7 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.7 mM | |
4 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
5 | Sap1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 15N][U-99% 13C; U-99% 15N] Sap1, 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sap1 | [U-99% 15N][U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 15N][U-99% 13C; U-99% 15N] Sap1, 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sap1 | [U-99% 15N][U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 13C; U-99% 15N] Sap1, 0.7 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.7 mM | |
4 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
5 | Sap1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 13C; U-99% 15N] Sap1, 0.7 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.7 mM | |
4 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
5 | Sap1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 13C; U-99% 15N] Sap1, 0.7 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.7 mM | |
4 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
5 | Sap1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 15N][U-99% 13C; U-99% 15N] Sap1, 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sap1 | [U-99% 15N][U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5 mM [U-99% 13C; U-99% 15N] Sap1, 0.7 mM DNA (5'-CAAAACAATATT-3'), 20 mM sodium phosphate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | DNA (5'-CAAAACAATATT-3') | natural abundance | 0.7 mM | |
4 | DNA (5'-GTTTTGTTATAA-3') | natural abundance | 0.0 ~ 0.0 mM | |
5 | Sap1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
6 | sodium phosphate | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_36001_5b7j.nef |
Input source #2: Coordindates | 5b7j.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- AKAQRTHLSLEEKIKLMRLVVRHKHELVDRKTSEFYAKIARIGYEDEGLAIHTESACRNQIISIMRVYEQRLAHRQPGMKTTPEEDELDQLCDEWKARLS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AKAQRTHLSLEEKIKLMRLVVRHKHELVDRKTSEFYAKIARIGYEDEGLAIHTESACRNQIISIMRVYEQRLAHRQPGMKTTPEEDELDQLCDEWKARLS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---130----- ELQQYREKFLV ||||||||||| ELQQYREKFLV -------110-
-------210-- CAAAACAATATT |||||||||||| CAAAACAATATT --------10--
-----220---- AATATTGTTTTG |||||||||||| AATATTGTTTTG --------10--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 111 | 0 | 0 | 100.0 |
B | B | 12 | 0 | 0 | 100.0 |
C | C | 12 | 0 | 0 | 100.0 |
Content subtype: combined_36001_5b7j.nef
Assigned chemical shifts
----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- AKAQRTHLSLEEKIKLMRLVVRHKHELVDRKTSEFYAKIARIGYEDEGLAIHTESACRNQIISIMRVYEQRLAHRQPGMKTTPEEDELDQLCDEWKARLS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| AKAQRTHLSLEEKIKLMRLVVRHKHELVDRKTSEFYAKIARIGYEDEGLAIHTESACRNQIISIMRVYEQRLAHRQPGMKTTPEEDE.DQLCDEWKARLS ---130----- ELQQYREKFLV ||||||||||| ELQQYREKFLV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 719 | 514 | 71.5 |
13C chemical shifts | 523 | 438 | 83.7 |
15N chemical shifts | 129 | 98 | 76.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 223 | 193 | 86.5 |
13C chemical shifts | 222 | 204 | 91.9 |
15N chemical shifts | 109 | 93 | 85.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 496 | 321 | 64.7 |
13C chemical shifts | 301 | 234 | 77.7 |
15N chemical shifts | 20 | 5 | 25.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 49 | 76.6 |
13C chemical shifts | 64 | 48 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 22 | 52.4 |
13C chemical shifts | 41 | 17 | 41.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-------210-- CAAAACAATATT ||||||||||| .AAAACAATATT
-----220---- AATATTGTTTTG ||||||||||| .ATATTGTTTTG
-----220---- AATATTGTTTTG ||||| || .ATATT...TT -----220---
-------210-- CAAAACAATATT |||||||||||| CAAAACAATATT
-----220---- AATATTGTTTTG |||||||||||| AATATTGTTTTG
Dihedral angle restraints
-------210-- CAAAACAATATT |||||||||||| CAAAACAATATT
-----220---- AATATTGTTTTG |||||||||||| AATATTGTTTTG