Complete 1H, 13C, and 15N Chemical Shift Assignments for the N-terminal Domain of DNA Polymerase B (residues 2-87).
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.4 % (900 of 1042) | 91.3 % (502 of 550) | 78.1 % (314 of 402) | 93.3 % (84 of 90) |
Backbone | 91.7 % (473 of 516) | 95.5 % (169 of 177) | 88.6 % (226 of 255) | 92.9 % (78 of 84) |
Sidechain | 81.5 % (495 of 607) | 89.3 % (333 of 373) | 68.4 % (156 of 228) | 100.0 % (6 of 6) |
Aromatic | 48.1 % (25 of 52) | 96.2 % (25 of 26) | 0.0 % (0 of 26) | |
Methyl | 98.0 % (96 of 98) | 100.0 % (49 of 49) | 95.9 % (47 of 49) |
1. DNA Polymerase B
MSKRKAPQET LNGGITDMLV ELANFEKNVS QAIHKYNAYR KAASVIAKYP HKIKSGAEAK KLPGVGTKIA EKIDEFLATG KLRKLEKTemperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Model GE GN-500 (500 MHz)
Temperature 298 (±0.5) K, pH 6.7 (±0.15), Details After purification the sample was eluted from a Sephadex G15 column (18 x 1.0 cm) with 5 mM Tris-d11, pH 7.5, 400 mM NaCl. Prior to performing NMR expeiments the pH was adjusted to 6.7.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DNA Polymerase B | [U-100% 13C; U-100% 15N] | 2.8 mM | |
2 | Tris-d11 | 5 mM | ||
3 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | DNA Polymerase B | [U-100% 15N] | 4.7 mM | |
5 | Tris-d11 | 5 mM | ||
6 | NaCl | 400 mM |
Temperature 298 (±0.5) K, pH 6.7 (±0.15)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DNA Polymerase B | 1.4 mM | ||
8 | Tris-d11 | 5 mM | ||
9 | NaCl | 400 mM |
Properties
Input source #1: Assigned chemical shifts - Assigned chemical shifts | bmr4326_3.str |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | OK |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr4326_3.str
# | Content subtype | Saveframe | Status | # of rows | Experiment type | Sequence coverage (%) |
---|---|---|---|---|---|---|
1 | Assigned chemical shifts | assigned_chemical_shifts | OK | 993 | 98.9 (chain: 1, length: 87) | |
1 | Chemical shift references | chemical_shift_reference | OK | 3 | No information |
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80------- MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 402 | 312 | 77.6 |
1H chemical shifts | 550 | 498 | 90.5 |
15N chemical shifts | 93 | 83 | 89.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 174 | 158 | 90.8 |
1H chemical shifts | 177 | 168 | 94.9 |
15N chemical shifts | 84 | 77 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 228 | 154 | 67.5 |
1H chemical shifts | 373 | 330 | 88.5 |
15N chemical shifts | 9 | 6 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 51 | 47 | 92.2 |
1H chemical shifts | 51 | 50 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 26 | 0 | 0.0 |
1H chemical shifts | 26 | 25 | 96.2 |