Solution NMR Studies of a 42kDa Escherichia coli Maltose Binding Protein/ Beta-Cyclodextrin Complex: Chemical Shift Assignments and Analysis
KTEEGKLVIW INGDKGYNGL AEVGKKFEKD TGIKVTVEHP DKLEEKFPQV AATGDGPDII FWAHDRFGGY AQSGLLAEIT PDKAFQDKLY PFTWDAVRYN GKLIAYPIAV EALSLIYNKD LLPNPPKTWE EIPALDKELK AKGKSALMFN LQEPYFTWPL IAADGGYAFK YENGKYDIKD VGVDNAGAKA GLTFLVDLIK NKHMNADTDY SIAEAAFNKG ETAMTINGPW AWSNIDTSKV NYGVTVLPTF KGQPSKPFVG VLSAGINAAS PNKELAKEFL ENYLLTDEGL EAVNKDKPLG AVALKSYEEE LAKDPRIAAT MENAQKGEIM PNIPQMSAFW YAVRTAVINA ASGRQTVDEA LKDAQTRITK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 55.4 % (2392 of 4316) | 36.0 % (806 of 2237) | 74.0 % (1252 of 1692) | 86.3 % (334 of 387) |
Backbone | 81.6 % (1778 of 2178) | 58.2 % (435 of 748) | 93.7 % (1013 of 1081) | 94.6 % (330 of 349) |
Sidechain | 38.0 % (941 of 2479) | 24.9 % (371 of 1489) | 59.5 % (566 of 952) | 10.5 % (4 of 38) |
Aromatic | 5.6 % (21 of 378) | 9.5 % (18 of 189) | 1.7 % (3 of 181) | 0.0 % (0 of 8) |
Methyl | 83.3 % (348 of 418) | 77.5 % (162 of 209) | 89.0 % (186 of 209) |
1. E. coli maltose binding protein
KTEEGKLVIW INGDKGYNGL AEVGKKFEKD TGIKVTVEHP DKLEEKFPQV AATGDGPDII FWAHDRFGGY AQSGLLAEIT PDKAFQDKLY PFTWDAVRYN GKLIAYPIAV EALSLIYNKD LLPNPPKTWE EIPALDKELK AKGKSALMFN LQEPYFTWPL IAADGGYAFK YENGKYDIKD VGVDNAGAKA GLTFLVDLIK NKHMNADTDY SIAEAAFNKG ETAMTINGPW AWSNIDTSKV NYGVTVLPTF KGQPSKPFVG VLSAGINAAS PNKELAKEFL ENYLLTDEGL EAVNKDKPLG AVALKSYEEE LAKDPRIAAT MENAQKGEIM PNIPQMSAFW YAVRTAVINA ASGRQTVDEA LKDAQTRITKTemperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Varian INOVA - 600 MHz
State isotropic, Temperature 310 (±0.2) K, pH 7.2 (±0.05), Details Exchangeable proton sites in MBP were fully protonated by partially unfolding this protein in 2.5M GuHCl at room temperature for 3hr and subsequently refolding in GuHCl-free phosphate buffer containing 2mM beta-cyclodextrin. The protein under study has high level (>95%) deuterium labeling at all aliphatic and aromatic sites except at the following methyl groups which are highly protonated: Ile d1, Val g1/g2 and Leu d1/d2. No attempt has been made here to correct the 2H isotope effects on the 15N and 13C chemical shifts that are reported.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | E. coli maltose binding protein | [U-15N;U-13C; U-2H;1H-95% Ile HD1, 1H-50% LeuHD1/HD2, 1H-85% Val HG1/HG2] | 0.7 ~ 0.9 mM | |
2 | BCD | 2.0 mM | ||
3 | sodium phosphate buffer | 20 mM | ||
4 | EDTA | 100 uM | ||
5 | Pefabloc | 0.1 mg/mL | ||
6 | pepstatin | 1.0 ug/uL | ||
7 | D2O | 10 % | ||
8 | H2O | 90 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr4354_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 KTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYN -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 GKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIK |||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GKLIAYPIAVEALSLIYNKDLLPN.PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIK -------210-------220-------230-------240-------250-------260-------270-------280-------290-------300 NKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLG |||||||||||||||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NKHMNADTDYSIAEAAFNKGETAMTING...W.........YGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLG -------310-------320-------330-------340-------350-------360-------370 AVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 1692 | 1198 | 70.8 |
15N chemical shifts | 393 | 330 | 84.0 |
1H chemical shifts | 2237 | 472 | 21.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 740 | 682 | 92.2 |
15N chemical shifts | 349 | 330 | 94.6 |
1H chemical shifts | 748 | 330 | 44.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 952 | 516 | 54.2 |
15N chemical shifts | 44 | 0 | 0.0 |
1H chemical shifts | 1489 | 142 | 9.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 215 | 183 | 85.1 |
1H chemical shifts | 215 | 140 | 65.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 181 | 0 | 0.0 |
15N chemical shifts | 8 | 0 | 0.0 |
1H chemical shifts | 189 | 2 | 1.1 |