Backbone 1H, 13C, and 15N Chemical Shift Assignments for Lysozyme
KVFGRCELAA AMKRHGLDNY RGYSLGNWVC AAKFESNFNT EATNRNTDGS TDYGILQINS RWWCNDGRTP GSRNLCNIPC SALLSSDITA SVNCAKKIVS DGNGMNAWVA WRNRCKGTDV QAWIRGCRL
Polymer type: polypeptide(L)
Total | 13C | 15N | |
---|---|---|---|
All | 74.5 % (519 of 697) | 67.9 % (372 of 548) | 98.7 % (147 of 149) |
Backbone | 97.8 % (491 of 502) | 97.3 % (365 of 375) | 99.2 % (126 of 127) |
Sidechain | 43.9 % (137 of 312) | 40.3 % (117 of 290) | 90.9 % (20 of 22) |
Aromatic | 13.8 % (9 of 65) | 6.8 % (4 of 59) | 83.3 % (5 of 6) |
Methyl | 20.3 % (12 of 59) | 20.3 % (12 of 59) |
1. hen egg white lysozyme
KVFGRCELAA AMKRHGLDNY RGYSLGNWVC AAKFESNFNT EATNRNTDGS TDYGILQINS RWWCNDGRTP GSRNLCNIPC SALLSSDITA SVNCAKKIVS DGNGMNAWVA WRNRCKGTDV QAWIRGCRLTemperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Temperature 308 (±1) K, pH 3.8 (±0.2)
List #1 residual_dipolar_couplings_1, RDC code 1DHN, Field strength (1H) 0.0 MHz
List #2 residual_dipolar_couplings_2, RDC code 1DHN, Field strength (1H) 0.0 MHz
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
#1 Model GE na (750 MHz) Details home built console
#2 Model GE na (600 MHz) Details home built console
#3 Model GE na (500 MHz) Details home built console
#4 Model Bruker na (800 MHz)
#5 Model Bruker na (600 MHz)
Temperature 308 (±1) K, pH 3.8 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hen egg white lysozyme | [U-95% 13C; U-98% 15N] | 1.5 mM |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC) and dihexanoyl-phosphatidylcholine (DHPC), [DMPC]/[DHPC]=2.9, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
3 | DMPC/DHPC | 5 % | ||
4 | phosphate | 10 mM | ||
5 | H2O | 93 % | ||
6 | D2O | 7 % |
Temperature 308 (±1) K, pH 3.8 (±0.2), Details dimyristoyl-phosphatidlycholine (DMPC), dihexanoyl-phosphatidylcholine (DHPC) and cetyltrimethylammonium bromide (CTBA). DMPC]:[DHPC]:[CTAB] = 2.9:1.0:0.1, in 10mM phosphate buffer at pH 6.5 (93%/7% H2O/D2O) with a small amount of dioxane for 1H chemical shift referencing
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | hen egg white lysozyme | [U-15N] | 0.5 mM | |
8 | DMPC/DHPC/CTAB | 7.5 % | ||
9 | phosphate | 10 mM | ||
10 | H2O | 93 % | ||
11 | D2O | 7 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr4831_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTEATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTEATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVS -------110-------120--------- DGNGMNAWVAWRNRCKGTDVQAWIRGCRL ||||||||||||||||||||||||||||| DGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 548 | 364 | 66.4 |
15N chemical shifts | 160 | 147 | 91.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 258 | 254 | 98.4 |
15N chemical shifts | 127 | 126 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 290 | 110 | 37.9 |
15N chemical shifts | 33 | 21 | 63.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 61 | 12 | 19.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 59 | 0 | 0.0 |
15N chemical shifts | 6 | 6 | 100.0 |